BLASTX nr result
ID: Mentha28_contig00036438
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Mentha28_contig00036438 (602 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EYU44864.1| hypothetical protein MIMGU_mgv1a011922mg [Mimulus... 61 3e-07 >gb|EYU44864.1| hypothetical protein MIMGU_mgv1a011922mg [Mimulus guttatus] Length = 266 Score = 60.8 bits (146), Expect = 3e-07 Identities = 37/70 (52%), Positives = 47/70 (67%), Gaps = 4/70 (5%) Frame = +1 Query: 376 VRLSNSRILSLPSLEMPRGIGLSLEDRLEPMVLDEAEQEQLYDRPS----TSKVQWPIRV 543 V LS++R S+PS E+ G G SLEDRLEPMVL+E E+EQ RPS +S + PI+ Sbjct: 7 VSLSSNRSHSVPSAEIFCGTGFSLEDRLEPMVLNEDEEEQPNARPSKENISSNMHGPIQD 66 Query: 544 VELNSVVNQS 573 VE +SV N S Sbjct: 67 VEFDSVANPS 76