BLASTX nr result
ID: Mentha28_contig00036188
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Mentha28_contig00036188 (429 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_007009467.1| Cysteine/Histidine-rich C1 domain family pro... 55 1e-05 >ref|XP_007009467.1| Cysteine/Histidine-rich C1 domain family protein, putative [Theobroma cacao] gi|508726380|gb|EOY18277.1| Cysteine/Histidine-rich C1 domain family protein, putative [Theobroma cacao] Length = 667 Score = 55.1 bits (131), Expect = 1e-05 Identities = 32/83 (38%), Positives = 40/83 (48%), Gaps = 1/83 (1%) Frame = -1 Query: 429 WMYHCRECDVSVHPDCFPNVSGRYQNIKFGRRYLDAALHRHPLTFLPLTSSRKPRCDLC- 253 W YHC CD S+HP C V GRY +K G Y+ + H HPLTF P C C Sbjct: 590 WFYHCVICDNSIHPKC---VIGRYSFMKLGHTYI-KSYHPHPLTFTKKVYD-YPECHQCD 644 Query: 252 RTRVDYGGTRGFQCCSDECEFFV 184 R +D +C +EC + V Sbjct: 645 RPCLDL----ALECLDNECNYIV 663