BLASTX nr result
ID: Mentha28_contig00036017
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Mentha28_contig00036017 (405 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value emb|CAN83560.1| hypothetical protein VITISV_024105 [Vitis vinifera] 57 2e-06 >emb|CAN83560.1| hypothetical protein VITISV_024105 [Vitis vinifera] Length = 394 Score = 57.4 bits (137), Expect = 2e-06 Identities = 22/32 (68%), Positives = 26/32 (81%) Frame = -1 Query: 390 FGHKPRGKMFCTHCNGSNHTIDKCYQLHGYPP 295 F +K R K THCNG+NHTIDKCY+LHG+PP Sbjct: 94 FSNKTREKFHYTHCNGTNHTIDKCYRLHGFPP 125