BLASTX nr result
ID: Mentha28_contig00034867
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Mentha28_contig00034867 (462 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|AAD29770.1|AF074021_2 putative transposon protein [Arabidopsi... 60 3e-07 >gb|AAD29770.1|AF074021_2 putative transposon protein [Arabidopsis thaliana] gi|7267214|emb|CAB80821.1| putative transposon protein [Arabidopsis thaliana] Length = 590 Score = 60.1 bits (144), Expect = 3e-07 Identities = 24/58 (41%), Positives = 37/58 (63%) Frame = -1 Query: 204 WKIRTRAYVKFIDIRAWRSIKNGWCPPKTIDEDRDVILKPKTEWTRDEIEDANFNEKA 31 WK+ + ++ ID+ AW ++++GW PP T D RD++ K +TEW DE AN N +A Sbjct: 356 WKVLIKRSIQSIDMDAWFAVEDGWMPPTTKDAKRDIVSKSRTEWIADEKTAANHNSQA 413