BLASTX nr result
ID: Mentha28_contig00034654
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Mentha28_contig00034654 (678 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_007015750.1| F-box and associated interaction domains-con... 59 2e-06 >ref|XP_007015750.1| F-box and associated interaction domains-containing protein, putative isoform 1 [Theobroma cacao] gi|590586605|ref|XP_007015751.1| F-box and associated interaction domains-containing protein, putative isoform 1 [Theobroma cacao] gi|508786113|gb|EOY33369.1| F-box and associated interaction domains-containing protein, putative isoform 1 [Theobroma cacao] gi|508786114|gb|EOY33370.1| F-box and associated interaction domains-containing protein, putative isoform 1 [Theobroma cacao] Length = 387 Score = 58.5 bits (140), Expect = 2e-06 Identities = 36/123 (29%), Positives = 64/123 (52%), Gaps = 3/123 (2%) Frame = +3 Query: 3 RFDNYPLPPT--TILDPVYDLLKYRGALGAVTYDREENPSSSMEIWKCDNIFRWNILYSV 176 +F PLP ++ LL + G+LGA+ Y RE S+++W + W +S+ Sbjct: 248 KFSTLPLPTFGGSLAQYYLQLLDFNGSLGAIVYPRE-GTEKSIDLWVMNG--SWTRQFSI 304 Query: 177 P-LSSVDRPVGLWKEQFVFLDGKSSTFDDNCGQLKVYDLHSGELNELSIYSYPNHMRVFS 353 +S V+RP+G WK +FL+ + +L ++D + EL L I++Y N M++ + Sbjct: 305 ESVSGVERPLGFWKNGELFLESSNH-------ELVLFDPATRELKNLGIHAYQNTMQLIA 357 Query: 354 YAK 362 Y + Sbjct: 358 YVE 360