BLASTX nr result
ID: Mentha28_contig00034620
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Mentha28_contig00034620 (373 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_004356761.1| PB1 domain containing protein [Acanthamoeba ... 70 3e-10 gb|EFY92904.1| ZZ type zinc finger domain-containing protein [Me... 70 4e-10 gb|EXV04416.1| ZZ type zinc finger domain protein [Metarhizium r... 69 9e-10 gb|EFY98453.1| ZZ type zinc finger domain-containing protein [Me... 69 9e-10 gb|EGO60287.1| hypothetical protein NEUTE1DRAFT_115669 [Neurospo... 68 1e-09 ref|XP_961062.1| hypothetical protein NCU04272 [Neurospora crass... 68 1e-09 gb|EQK99808.1| ZZ type zinc finger domain-containing protein [Op... 66 4e-09 emb|CCE29478.1| uncharacterized protein CPUR_03171 [Claviceps pu... 65 7e-09 ref|XP_002835794.1| hypothetical protein [Tuber melanosporum Mel... 65 7e-09 emb|CCO29832.1| putative protein C6orf106 homolog [Rhizoctonia s... 65 1e-08 gb|EXX70328.1| hypothetical protein RirG_088570 [Rhizophagus irr... 65 1e-08 gb|EXX70327.1| hypothetical protein RirG_088570 [Rhizophagus irr... 65 1e-08 gb|ESA10449.1| hypothetical protein GLOINDRAFT_348194 [Rhizophag... 65 1e-08 gb|ESA05211.1| hypothetical protein GLOINDRAFT_228954, partial [... 65 1e-08 ref|XP_791508.1| PREDICTED: next to BRCA1 gene 1 protein-like [S... 65 1e-08 gb|EPE08192.1| zz type zinc finger domain-containing protein [Op... 64 2e-08 gb|ELU41185.1| ZZ domain-containing protein [Rhizoctonia solani ... 64 2e-08 gb|EPQ25667.1| hypothetical protein PFL1_06739 [Pseudozyma flocc... 64 3e-08 gb|EUC54769.1| ZZ type zinc finger protein, partial [Rhizoctonia... 63 4e-08 gb|EPB86744.1| hypothetical protein HMPREF1544_06442 [Mucor circ... 63 4e-08 >ref|XP_004356761.1| PB1 domain containing protein [Acanthamoeba castellanii str. Neff] gi|440803978|gb|ELR24861.1| PB1 domain containing protein [Acanthamoeba castellanii str. Neff] Length = 603 Score = 70.1 bits (170), Expect = 3e-10 Identities = 31/50 (62%), Positives = 33/50 (66%) Frame = +2 Query: 5 HHAICDKCESFINGIRYKCLHCPDYDLCSKCEEENSNFHFHDETHVFAKI 154 HHAICD CES I GIRYKC CPDYDLC CE + HD TH F K+ Sbjct: 228 HHAICDACESRIVGIRYKCTSCPDYDLCEACEAKTP--AVHDSTHYFIKL 275 >gb|EFY92904.1| ZZ type zinc finger domain-containing protein [Metarhizium acridum CQMa 102] Length = 865 Score = 69.7 bits (169), Expect = 4e-10 Identities = 31/60 (51%), Positives = 38/60 (63%) Frame = +2 Query: 5 HHAICDKCESFINGIRYKCLHCPDYDLCSKCEEENSNFHFHDETHVFAKITNPSHSLPAS 184 HHAICD C+S+I G+R+KCL CPD+D C++C E N HF H FA I P L S Sbjct: 420 HHAICDGCDSYITGVRHKCLDCPDWDYCAECAE---NAHFVHPNHRFAAIYEPLADLHTS 476 >gb|EXV04416.1| ZZ type zinc finger domain protein [Metarhizium robertsii] Length = 860 Score = 68.6 bits (166), Expect = 9e-10 Identities = 30/60 (50%), Positives = 38/60 (63%) Frame = +2 Query: 5 HHAICDKCESFINGIRYKCLHCPDYDLCSKCEEENSNFHFHDETHVFAKITNPSHSLPAS 184 HHAICD C+++I G+R+KCL CPD+D C++C E N HF H FA I P L S Sbjct: 417 HHAICDGCDAYITGVRHKCLDCPDWDYCAECAE---NAHFVHPNHRFAAIYEPLADLHTS 473 >gb|EFY98453.1| ZZ type zinc finger domain-containing protein [Metarhizium anisopliae ARSEF 23] Length = 897 Score = 68.6 bits (166), Expect = 9e-10 Identities = 30/60 (50%), Positives = 38/60 (63%) Frame = +2 Query: 5 HHAICDKCESFINGIRYKCLHCPDYDLCSKCEEENSNFHFHDETHVFAKITNPSHSLPAS 184 HHAICD C+++I G+R+KCL CPD+D C++C E N HF H FA I P L S Sbjct: 454 HHAICDGCDAYITGVRHKCLDCPDWDYCAECAE---NAHFVHPNHRFAAIYEPLADLHTS 510 >gb|EGO60287.1| hypothetical protein NEUTE1DRAFT_115669 [Neurospora tetrasperma FGSC 2508] gi|350294664|gb|EGZ75749.1| hypothetical protein NEUTE2DRAFT_143813 [Neurospora tetrasperma FGSC 2509] Length = 866 Score = 68.2 bits (165), Expect = 1e-09 Identities = 31/79 (39%), Positives = 40/79 (50%) Frame = +2 Query: 5 HHAICDKCESFINGIRYKCLHCPDYDLCSKCEEENSNFHFHDETHVFAKITNPSHSLPAS 184 HHAICD C+ I G+R+KCL CPD+D CS C E S H + + P+H P Sbjct: 434 HHAICDGCDKDIRGVRHKCLQCPDWDYCSNCYESASYIHANHRFVPIYEPLEPTHMCPVP 493 Query: 185 RGGHRMGGCHPHMRARHNR 241 R +G C +NR Sbjct: 494 RALTHVGVCCDGPLCNNNR 512 >ref|XP_961062.1| hypothetical protein NCU04272 [Neurospora crassa OR74A] gi|16944480|emb|CAD11405.1| conserved hypothetical protein [Neurospora crassa] gi|553136136|gb|ESA42685.1| ZZ type zinc finger domain-containing protein [Neurospora crassa OR74A] gi|553136137|gb|ESA42686.1| ZZ type zinc finger domain-containing protein, variant [Neurospora crassa OR74A] Length = 867 Score = 68.2 bits (165), Expect = 1e-09 Identities = 31/79 (39%), Positives = 40/79 (50%) Frame = +2 Query: 5 HHAICDKCESFINGIRYKCLHCPDYDLCSKCEEENSNFHFHDETHVFAKITNPSHSLPAS 184 HHAICD C+ I G+R+KCL CPD+D CS C E S H + + P+H P Sbjct: 435 HHAICDGCDKDIRGVRHKCLQCPDWDYCSNCYESASYIHANHRFVPIYEPLEPTHMCPVP 494 Query: 185 RGGHRMGGCHPHMRARHNR 241 R +G C +NR Sbjct: 495 RALTHVGVCCDGPLCNNNR 513 >gb|EQK99808.1| ZZ type zinc finger domain-containing protein [Ophiocordyceps sinensis CO18] Length = 928 Score = 66.2 bits (160), Expect = 4e-09 Identities = 31/67 (46%), Positives = 41/67 (61%), Gaps = 3/67 (4%) Frame = +2 Query: 5 HHAICDKCESFINGIRYKCLHCPDYDLCSKCEEENSNFHFHDETHVFAKITNP---SHSL 175 HHAICD C+ +I G+R+KCL CPD+D CS+C N HF H FA I P + + Sbjct: 487 HHAICDGCDKYITGVRHKCLDCPDWDYCSECV---LNVHFVHANHRFAPIYEPLANTQAW 543 Query: 176 PASRGGH 196 PA++ H Sbjct: 544 PAAQPIH 550 >emb|CCE29478.1| uncharacterized protein CPUR_03171 [Claviceps purpurea 20.1] Length = 905 Score = 65.5 bits (158), Expect = 7e-09 Identities = 29/60 (48%), Positives = 39/60 (65%) Frame = +2 Query: 5 HHAICDKCESFINGIRYKCLHCPDYDLCSKCEEENSNFHFHDETHVFAKITNPSHSLPAS 184 HHAICD C++ I G+R+KCL CPD+D C++C + N HF +H F I P SL A+ Sbjct: 440 HHAICDGCDANITGVRHKCLDCPDWDYCAECVQ---NAHFVHPSHRFVTIYEPLTSLHAA 496 >ref|XP_002835794.1| hypothetical protein [Tuber melanosporum Mel28] gi|295629587|emb|CAZ79951.1| unnamed protein product [Tuber melanosporum] Length = 472 Score = 65.5 bits (158), Expect = 7e-09 Identities = 27/51 (52%), Positives = 34/51 (66%) Frame = +2 Query: 14 ICDKCESFINGIRYKCLHCPDYDLCSKCEEENSNFHFHDETHVFAKITNPS 166 +CD C+ + G RYKC+ C DYDLC+ CE E S FHD +H+F KI N S Sbjct: 16 VCDGCDRGLVGPRYKCVQCADYDLCAICEGELSEQKFHDTSHIFVKIRNSS 66 >emb|CCO29832.1| putative protein C6orf106 homolog [Rhizoctonia solani AG-1 IB] Length = 1186 Score = 65.1 bits (157), Expect = 1e-08 Identities = 27/53 (50%), Positives = 35/53 (66%), Gaps = 2/53 (3%) Frame = +2 Query: 2 KHHAICDKCESFINGIRYKCLH--CPDYDLCSKCEEENSNFHFHDETHVFAKI 154 +HHA CD C+ I G+RYKC+H CPD+D+C +CE F H ETH F K+ Sbjct: 571 RHHARCDVCQKQITGVRYKCIHPSCPDFDICERCEA--LPFAVHPETHAFVKL 621 Score = 56.2 bits (134), Expect = 4e-06 Identities = 23/55 (41%), Positives = 29/55 (52%) Frame = +2 Query: 17 CDKCESFINGIRYKCLHCPDYDLCSKCEEENSNFHFHDETHVFAKITNPSHSLPA 181 CD C+ ING R+KC++CPDYDLC C H H F I +P + A Sbjct: 199 CDSCQKIINGNRHKCMNCPDYDLCDACYTSGFPAFDHSPVHRFMHIEHPIRVITA 253 >gb|EXX70328.1| hypothetical protein RirG_088570 [Rhizophagus irregularis DAOM 197198w] Length = 358 Score = 64.7 bits (156), Expect = 1e-08 Identities = 27/53 (50%), Positives = 32/53 (60%) Frame = +2 Query: 5 HHAICDKCESFINGIRYKCLHCPDYDLCSKCEEENSNFHFHDETHVFAKITNP 163 H A C+ C +I G+RYKC HC D+D+CS CE N HD HVF KI P Sbjct: 263 HPAYCNVCNKYIVGVRYKCGHCDDFDICSNCETSN-----HDRNHVFIKIKRP 310 >gb|EXX70327.1| hypothetical protein RirG_088570 [Rhizophagus irregularis DAOM 197198w] Length = 411 Score = 64.7 bits (156), Expect = 1e-08 Identities = 27/53 (50%), Positives = 32/53 (60%) Frame = +2 Query: 5 HHAICDKCESFINGIRYKCLHCPDYDLCSKCEEENSNFHFHDETHVFAKITNP 163 H A C+ C +I G+RYKC HC D+D+CS CE N HD HVF KI P Sbjct: 263 HPAYCNVCNKYIVGVRYKCGHCDDFDICSNCETSN-----HDRNHVFIKIKRP 310 Score = 62.0 bits (149), Expect = 8e-08 Identities = 26/53 (49%), Positives = 33/53 (62%) Frame = +2 Query: 5 HHAICDKCESFINGIRYKCLHCPDYDLCSKCEEENSNFHFHDETHVFAKITNP 163 H AIC+ C I G+RYKC HC +++C CE F+ HD+THVF KI P Sbjct: 337 HKAICNVCHKKIRGVRYKCGHCAKFEMCVNCEA--YPFNLHDQTHVFIKIRRP 387 >gb|ESA10449.1| hypothetical protein GLOINDRAFT_348194 [Rhizophagus irregularis DAOM 181602] gi|595482761|gb|EXX70317.1| hypothetical protein RirG_088490 [Rhizophagus irregularis DAOM 197198w] Length = 249 Score = 64.7 bits (156), Expect = 1e-08 Identities = 29/56 (51%), Positives = 33/56 (58%) Frame = +2 Query: 2 KHHAICDKCESFINGIRYKCLHCPDYDLCSKCEEENSNFHFHDETHVFAKITNPSH 169 KH CD C + I GIRYKC HC D+DLCS C +HD HVF KI +P H Sbjct: 107 KHPCTCDSCNTTITGIRYKCGHCADFDLCSLCIGT-----YHDYNHVFLKIRHPVH 157 Score = 55.5 bits (132), Expect = 8e-06 Identities = 27/55 (49%), Positives = 37/55 (67%), Gaps = 2/55 (3%) Frame = +2 Query: 5 HHAI-CDKC-ESFINGIRYKCLHCPDYDLCSKCEEENSNFHFHDETHVFAKITNP 163 H+++ CD C +S I GIRYKC +C D+D+C KCE S HDE+H+F K+ P Sbjct: 177 HNSVYCDICGKSPICGIRYKCGNCRDFDVCGKCEVSISK--LHDESHIFIKLNRP 229 >gb|ESA05211.1| hypothetical protein GLOINDRAFT_228954, partial [Rhizophagus irregularis DAOM 181602] Length = 233 Score = 64.7 bits (156), Expect = 1e-08 Identities = 27/53 (50%), Positives = 32/53 (60%) Frame = +2 Query: 5 HHAICDKCESFINGIRYKCLHCPDYDLCSKCEEENSNFHFHDETHVFAKITNP 163 H A C+ C +I G+RYKC HC D+D+CS CE N HD HVF KI P Sbjct: 85 HPAYCNVCNKYIVGVRYKCGHCDDFDICSNCETSN-----HDRNHVFIKIKRP 132 Score = 62.0 bits (149), Expect = 8e-08 Identities = 26/53 (49%), Positives = 33/53 (62%) Frame = +2 Query: 5 HHAICDKCESFINGIRYKCLHCPDYDLCSKCEEENSNFHFHDETHVFAKITNP 163 H AIC+ C I G+RYKC HC +++C CE F+ HD+THVF KI P Sbjct: 159 HKAICNVCHKKIRGVRYKCGHCAKFEMCVNCEA--YPFNLHDQTHVFIKIRRP 209 >ref|XP_791508.1| PREDICTED: next to BRCA1 gene 1 protein-like [Strongylocentrotus purpuratus] Length = 1109 Score = 64.7 bits (156), Expect = 1e-08 Identities = 27/59 (45%), Positives = 35/59 (59%) Frame = +2 Query: 17 CDKCESFINGIRYKCLHCPDYDLCSKCEEENSNFHFHDETHVFAKITNPSHSLPASRGG 193 CDKCE I G RYKC HC D+DLC +CE + + HD HVF K+ P++ + G Sbjct: 258 CDKCEGVITGFRYKCGHCLDFDLCEECEAQPGS---HDPNHVFLKLKRPAYRVGVKSDG 313 >gb|EPE08192.1| zz type zinc finger domain-containing protein [Ophiostoma piceae UAMH 11346] Length = 912 Score = 64.3 bits (155), Expect = 2e-08 Identities = 27/61 (44%), Positives = 35/61 (57%) Frame = +2 Query: 2 KHHAICDKCESFINGIRYKCLHCPDYDLCSKCEEENSNFHFHDETHVFAKITNPSHSLPA 181 +H+AICD CE FI G+RYKC+ CPD+DLCS C H H F + P +P Sbjct: 456 RHNAICDGCEVFITGVRYKCMQCPDWDLCSDCINSADKTH---AEHRFVPVFEPLPEIPV 512 Query: 182 S 184 + Sbjct: 513 A 513 >gb|ELU41185.1| ZZ domain-containing protein [Rhizoctonia solani AG-1 IA] Length = 1282 Score = 63.9 bits (154), Expect = 2e-08 Identities = 27/53 (50%), Positives = 34/53 (64%), Gaps = 2/53 (3%) Frame = +2 Query: 2 KHHAICDKCESFINGIRYKCLH--CPDYDLCSKCEEENSNFHFHDETHVFAKI 154 +HHA CD C+ I G RYKC+H CPD+D+C +CE F H ETH F K+ Sbjct: 656 RHHARCDVCQKQITGTRYKCIHPSCPDFDICERCEA--MPFAVHPETHAFVKL 706 Score = 56.2 bits (134), Expect = 4e-06 Identities = 24/50 (48%), Positives = 28/50 (56%) Frame = +2 Query: 5 HHAICDKCESFINGIRYKCLHCPDYDLCSKCEEENSNFHFHDETHVFAKI 154 H A CD C S I G+RYKC CPDYD+C C + H H FAK+ Sbjct: 593 HSAACDMCSSRIRGVRYKCTACPDYDVCESCFRVSEEVH---PGHSFAKV 639 >gb|EPQ25667.1| hypothetical protein PFL1_06739 [Pseudozyma flocculosa PF-1] Length = 1400 Score = 63.5 bits (153), Expect = 3e-08 Identities = 33/75 (44%), Positives = 44/75 (58%) Frame = +2 Query: 2 KHHAICDKCESFINGIRYKCLHCPDYDLCSKCEEENSNFHFHDETHVFAKITNPSHSLPA 181 KH AICD C++ I G+RYKCL CPD+D C C E + H H F +IT+P+ S+ + Sbjct: 668 KHTAICDLCQATIYGVRYKCLDCPDWDCCGACHAETAAKH---PDHRFVRITDPA-SISS 723 Query: 182 SRGGHRMGGCHPHMR 226 S M CH +R Sbjct: 724 STAA--MLPCHRAIR 736 >gb|EUC54769.1| ZZ type zinc finger protein, partial [Rhizoctonia solani AG-3 Rhs1AP] Length = 216 Score = 63.2 bits (152), Expect = 4e-08 Identities = 27/53 (50%), Positives = 35/53 (66%), Gaps = 2/53 (3%) Frame = +2 Query: 2 KHHAICDKCESFINGIRYKCLH--CPDYDLCSKCEEENSNFHFHDETHVFAKI 154 +HHA CD C I G+RYKC+H CPD+D+C +CE F H +THVF K+ Sbjct: 119 RHHAQCDVCHKQILGVRYKCIHPTCPDFDICGRCEV--LPFAVHPDTHVFVKL 169 >gb|EPB86744.1| hypothetical protein HMPREF1544_06442 [Mucor circinelloides f. circinelloides 1006PhL] Length = 880 Score = 63.2 bits (152), Expect = 4e-08 Identities = 27/53 (50%), Positives = 34/53 (64%) Frame = +2 Query: 17 CDKCESFINGIRYKCLHCPDYDLCSKCEEENSNFHFHDETHVFAKITNPSHSL 175 CD C++ I GIRYKC HC +YDLC CE + + HD+TH F KI P S+ Sbjct: 345 CDHCQANIEGIRYKCGHCTNYDLCETCEHQAA--FIHDKTHAFIKIRYPIQSI 395