BLASTX nr result
ID: Mentha28_contig00034587
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Mentha28_contig00034587 (406 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EYU27651.1| hypothetical protein MIMGU_mgv1a003669mg [Mimulus... 62 1e-07 >gb|EYU27651.1| hypothetical protein MIMGU_mgv1a003669mg [Mimulus guttatus] gi|604314946|gb|EYU27652.1| hypothetical protein MIMGU_mgv1a003669mg [Mimulus guttatus] Length = 570 Score = 61.6 bits (148), Expect = 1e-07 Identities = 32/50 (64%), Positives = 40/50 (80%), Gaps = 3/50 (6%) Frame = -3 Query: 245 MRDLAIKTREAGPGSPVAG---VSPRADMGEVDTRAPFQSVKDAVNLFGE 105 M D A+K+R+ GPGSP+A +SPR D+GE+DTR+PFQSVK AV LFGE Sbjct: 1 MFDFAVKSRQNGPGSPMAAATTLSPR-DVGEIDTRSPFQSVKAAVTLFGE 49