BLASTX nr result
ID: Mentha28_contig00034412
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Mentha28_contig00034412 (324 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EYU19891.1| hypothetical protein MIMGU_mgv1a026881mg [Mimulus... 65 1e-08 >gb|EYU19891.1| hypothetical protein MIMGU_mgv1a026881mg [Mimulus guttatus] Length = 1188 Score = 65.1 bits (157), Expect = 1e-08 Identities = 27/55 (49%), Positives = 42/55 (76%) Frame = -2 Query: 167 VVGPCFKGDNMDISSIPPGFESLVPFPLRKMEHDQVSNYSSAGKPFRAENIQLES 3 +VGPC K D+M+I SIPPGFES VPF +++ E +QV +YSS+ + ++ ++LE+ Sbjct: 5 LVGPCMKEDSMEIPSIPPGFESFVPFTVKRAEDNQVGSYSSSARVVESQTVKLET 59