BLASTX nr result
ID: Mentha28_contig00033802
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Mentha28_contig00033802 (361 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EYU32224.1| hypothetical protein MIMGU_mgv1a026990mg [Mimulus... 56 6e-06 >gb|EYU32224.1| hypothetical protein MIMGU_mgv1a026990mg [Mimulus guttatus] Length = 518 Score = 55.8 bits (133), Expect = 6e-06 Identities = 33/54 (61%), Positives = 35/54 (64%) Frame = +1 Query: 199 MEPKFLISSHKMPSSACAVPFFLSCNPSPLQKSKSYPNFCLSTTYGTLSKTPFL 360 MEPKFLISSHK S CA+PFF S N S LQK KS LS + L KTPFL Sbjct: 1 MEPKFLISSHKASPSVCALPFFPSRNSSLLQKPKSCR---LSLSSEKLKKTPFL 51