BLASTX nr result
ID: Mentha28_contig00033605
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Mentha28_contig00033605 (315 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EPS60687.1| hypothetical protein M569_14115, partial [Genlise... 68 1e-09 ref|XP_006370752.1| hypothetical protein POPTR_0001s46080g [Popu... 67 3e-09 ref|XP_002300541.2| hypothetical protein POPTR_0001s46080g [Popu... 67 3e-09 ref|XP_002317027.2| hypothetical protein POPTR_0011s14840g [Popu... 66 4e-09 ref|XP_006364829.1| PREDICTED: serine/threonine-protein phosphat... 65 7e-09 ref|XP_004232596.1| PREDICTED: serine/threonine-protein phosphat... 65 7e-09 ref|XP_004252040.1| PREDICTED: serine/threonine-protein phosphat... 65 1e-08 gb|EYU25688.1| hypothetical protein MIMGU_mgv1a007712mg [Mimulus... 64 2e-08 ref|XP_006849951.1| hypothetical protein AMTR_s00022p00138420 [A... 64 2e-08 ref|XP_004164611.1| PREDICTED: LOW QUALITY PROTEIN: serine/threo... 64 2e-08 ref|XP_004146184.1| PREDICTED: serine/threonine-protein phosphat... 64 2e-08 dbj|BAD10068.1| putative phosphoprotein phosphatase PP7 [Oryza s... 64 2e-08 gb|ABK24367.1| unknown [Picea sitchensis] 64 2e-08 ref|XP_002528524.1| protein phosphatase-7, putative [Ricinus com... 63 4e-08 ref|XP_006660276.1| PREDICTED: serine/threonine-protein phosphat... 63 5e-08 ref|XP_007211137.1| hypothetical protein PRUPE_ppa026357mg [Prun... 63 5e-08 ref|XP_007210105.1| hypothetical protein PRUPE_ppa021894mg, part... 63 5e-08 tpg|DAA48032.1| TPA: putative serine/threonine protein phosphata... 63 5e-08 tpg|DAA48031.1| TPA: putative serine/threonine protein phosphata... 63 5e-08 tpg|DAA48030.1| TPA: putative serine/threonine protein phosphata... 63 5e-08 >gb|EPS60687.1| hypothetical protein M569_14115, partial [Genlisea aurea] Length = 398 Score = 67.8 bits (164), Expect = 1e-09 Identities = 32/45 (71%), Positives = 36/45 (80%) Frame = -2 Query: 314 DDRFFVFNGDYVDRGAWGLEVFLLLLAWKVRIVLRELVVFGYDSS 180 DDRFFVFNGDYVDRGAWGLEVFLLLL+WKV + R ++ G S Sbjct: 82 DDRFFVFNGDYVDRGAWGLEVFLLLLSWKVLMPKRIYLLRGNHES 126 >ref|XP_006370752.1| hypothetical protein POPTR_0001s46080g [Populus trichocarpa] gi|550349999|gb|ERP67321.1| hypothetical protein POPTR_0001s46080g [Populus trichocarpa] Length = 316 Score = 66.6 bits (161), Expect = 3e-09 Identities = 31/45 (68%), Positives = 35/45 (77%) Frame = -2 Query: 314 DDRFFVFNGDYVDRGAWGLEVFLLLLAWKVRIVLRELVVFGYDSS 180 +DRFFVFNGDYVDRGAWGLE FLLLLAWKV + R ++ G S Sbjct: 12 EDRFFVFNGDYVDRGAWGLETFLLLLAWKVFLPQRVFLLRGNHES 56 >ref|XP_002300541.2| hypothetical protein POPTR_0001s46080g [Populus trichocarpa] gi|550349998|gb|EEE85346.2| hypothetical protein POPTR_0001s46080g [Populus trichocarpa] Length = 291 Score = 66.6 bits (161), Expect = 3e-09 Identities = 31/45 (68%), Positives = 35/45 (77%) Frame = -2 Query: 314 DDRFFVFNGDYVDRGAWGLEVFLLLLAWKVRIVLRELVVFGYDSS 180 +DRFFVFNGDYVDRGAWGLE FLLLLAWKV + R ++ G S Sbjct: 12 EDRFFVFNGDYVDRGAWGLETFLLLLAWKVFLPQRVFLLRGNHES 56 >ref|XP_002317027.2| hypothetical protein POPTR_0011s14840g [Populus trichocarpa] gi|550328417|gb|EEE97639.2| hypothetical protein POPTR_0011s14840g [Populus trichocarpa] Length = 452 Score = 66.2 bits (160), Expect = 4e-09 Identities = 31/45 (68%), Positives = 35/45 (77%) Frame = -2 Query: 314 DDRFFVFNGDYVDRGAWGLEVFLLLLAWKVRIVLRELVVFGYDSS 180 +DRFFVFNGDYVDRGAWGLE FLLLLAWKV + R ++ G S Sbjct: 148 EDRFFVFNGDYVDRGAWGLETFLLLLAWKVFLPQRVYLLRGNHES 192 >ref|XP_006364829.1| PREDICTED: serine/threonine-protein phosphatase 7-like isoform X1 [Solanum tuberosum] gi|565398537|ref|XP_006364830.1| PREDICTED: serine/threonine-protein phosphatase 7-like isoform X2 [Solanum tuberosum] Length = 459 Score = 65.5 bits (158), Expect = 7e-09 Identities = 31/45 (68%), Positives = 34/45 (75%) Frame = -2 Query: 314 DDRFFVFNGDYVDRGAWGLEVFLLLLAWKVRIVLRELVVFGYDSS 180 DDRFFVFNGDYVDRGAWGLE FL LLAWKV + R ++ G S Sbjct: 157 DDRFFVFNGDYVDRGAWGLETFLTLLAWKVFMPNRVFLLRGNHES 201 >ref|XP_004232596.1| PREDICTED: serine/threonine-protein phosphatase 7-like [Solanum lycopersicum] Length = 459 Score = 65.5 bits (158), Expect = 7e-09 Identities = 31/45 (68%), Positives = 34/45 (75%) Frame = -2 Query: 314 DDRFFVFNGDYVDRGAWGLEVFLLLLAWKVRIVLRELVVFGYDSS 180 DDRFFVFNGDYVDRGAWGLE FL LLAWKV + R ++ G S Sbjct: 157 DDRFFVFNGDYVDRGAWGLETFLTLLAWKVFMPNRVFLLRGNHES 201 >ref|XP_004252040.1| PREDICTED: serine/threonine-protein phosphatase 7 long form homolog [Solanum lycopersicum] Length = 909 Score = 64.7 bits (156), Expect = 1e-08 Identities = 29/45 (64%), Positives = 36/45 (80%) Frame = -2 Query: 314 DDRFFVFNGDYVDRGAWGLEVFLLLLAWKVRIVLRELVVFGYDSS 180 ++RFFVFNGDYVDRGAWGLE FLLLLAWK+ + R +++ G S Sbjct: 775 ENRFFVFNGDYVDRGAWGLETFLLLLAWKILMPNRVILLRGNHES 819 >gb|EYU25688.1| hypothetical protein MIMGU_mgv1a007712mg [Mimulus guttatus] Length = 398 Score = 63.9 bits (154), Expect = 2e-08 Identities = 30/44 (68%), Positives = 35/44 (79%) Frame = -2 Query: 311 DRFFVFNGDYVDRGAWGLEVFLLLLAWKVRIVLRELVVFGYDSS 180 +RF+VFNGDYVDRGAWGLEVFLLLLAWKV + R ++ G S Sbjct: 83 NRFYVFNGDYVDRGAWGLEVFLLLLAWKVLMPQRVYLLRGNHES 126 >ref|XP_006849951.1| hypothetical protein AMTR_s00022p00138420 [Amborella trichopoda] gi|548853549|gb|ERN11532.1| hypothetical protein AMTR_s00022p00138420 [Amborella trichopoda] Length = 531 Score = 63.9 bits (154), Expect = 2e-08 Identities = 29/45 (64%), Positives = 36/45 (80%) Frame = -2 Query: 314 DDRFFVFNGDYVDRGAWGLEVFLLLLAWKVRIVLRELVVFGYDSS 180 ++R+FVFNGDYVDRGAWGLE FLLLLAWKV + R +++ G S Sbjct: 228 NERYFVFNGDYVDRGAWGLETFLLLLAWKVFLPHRVILLRGNHES 272 >ref|XP_004164611.1| PREDICTED: LOW QUALITY PROTEIN: serine/threonine-protein phosphatase 7-like [Cucumis sativus] Length = 476 Score = 63.9 bits (154), Expect = 2e-08 Identities = 30/45 (66%), Positives = 35/45 (77%) Frame = -2 Query: 314 DDRFFVFNGDYVDRGAWGLEVFLLLLAWKVRIVLRELVVFGYDSS 180 ++RFFVFNGDYVDRGAWGLE FLLLLAWKV + R ++ G S Sbjct: 161 ENRFFVFNGDYVDRGAWGLETFLLLLAWKVFMPHRVFLLRGNHES 205 >ref|XP_004146184.1| PREDICTED: serine/threonine-protein phosphatase 7-like [Cucumis sativus] Length = 465 Score = 63.9 bits (154), Expect = 2e-08 Identities = 30/45 (66%), Positives = 35/45 (77%) Frame = -2 Query: 314 DDRFFVFNGDYVDRGAWGLEVFLLLLAWKVRIVLRELVVFGYDSS 180 ++RFFVFNGDYVDRGAWGLE FLLLLAWKV + R ++ G S Sbjct: 161 ENRFFVFNGDYVDRGAWGLETFLLLLAWKVFMPHRVFLLRGNHES 205 >dbj|BAD10068.1| putative phosphoprotein phosphatase PP7 [Oryza sativa Japonica Group] gi|125562160|gb|EAZ07608.1| hypothetical protein OsI_29859 [Oryza sativa Indica Group] gi|125603993|gb|EAZ43318.1| hypothetical protein OsJ_27914 [Oryza sativa Japonica Group] Length = 428 Score = 63.9 bits (154), Expect = 2e-08 Identities = 28/30 (93%), Positives = 28/30 (93%) Frame = -2 Query: 314 DDRFFVFNGDYVDRGAWGLEVFLLLLAWKV 225 DDR FVFNGDYVDRGAWGLE FLLLLAWKV Sbjct: 118 DDRVFVFNGDYVDRGAWGLETFLLLLAWKV 147 >gb|ABK24367.1| unknown [Picea sitchensis] Length = 434 Score = 63.9 bits (154), Expect = 2e-08 Identities = 30/44 (68%), Positives = 34/44 (77%) Frame = -2 Query: 311 DRFFVFNGDYVDRGAWGLEVFLLLLAWKVRIVLRELVVFGYDSS 180 +RFFVFNGDYVDRGAWGLE FLLLLAWKV + R ++ G S Sbjct: 133 NRFFVFNGDYVDRGAWGLETFLLLLAWKVLLPHRVFLLRGNHES 176 >ref|XP_002528524.1| protein phosphatase-7, putative [Ricinus communis] gi|223532026|gb|EEF33836.1| protein phosphatase-7, putative [Ricinus communis] Length = 166 Score = 63.2 bits (152), Expect = 4e-08 Identities = 27/29 (93%), Positives = 28/29 (96%) Frame = -2 Query: 314 DDRFFVFNGDYVDRGAWGLEVFLLLLAWK 228 D+RFFVFNGDYVDRGAWGLE FLLLLAWK Sbjct: 135 DNRFFVFNGDYVDRGAWGLETFLLLLAWK 163 >ref|XP_006660276.1| PREDICTED: serine/threonine-protein phosphatase 7-like, partial [Oryza brachyantha] Length = 361 Score = 62.8 bits (151), Expect = 5e-08 Identities = 27/30 (90%), Positives = 28/30 (93%) Frame = -2 Query: 314 DDRFFVFNGDYVDRGAWGLEVFLLLLAWKV 225 +DR FVFNGDYVDRGAWGLE FLLLLAWKV Sbjct: 51 EDRIFVFNGDYVDRGAWGLETFLLLLAWKV 80 >ref|XP_007211137.1| hypothetical protein PRUPE_ppa026357mg [Prunus persica] gi|462406872|gb|EMJ12336.1| hypothetical protein PRUPE_ppa026357mg [Prunus persica] Length = 355 Score = 62.8 bits (151), Expect = 5e-08 Identities = 29/45 (64%), Positives = 35/45 (77%) Frame = -2 Query: 314 DDRFFVFNGDYVDRGAWGLEVFLLLLAWKVRIVLRELVVFGYDSS 180 ++RFFVFNGDYVDRGAWGLE FL+LLAWKV + R ++ G S Sbjct: 114 ENRFFVFNGDYVDRGAWGLESFLILLAWKVLMPKRVYLLRGNHES 158 >ref|XP_007210105.1| hypothetical protein PRUPE_ppa021894mg, partial [Prunus persica] gi|462405840|gb|EMJ11304.1| hypothetical protein PRUPE_ppa021894mg, partial [Prunus persica] Length = 285 Score = 62.8 bits (151), Expect = 5e-08 Identities = 29/45 (64%), Positives = 35/45 (77%) Frame = -2 Query: 314 DDRFFVFNGDYVDRGAWGLEVFLLLLAWKVRIVLRELVVFGYDSS 180 ++RFFVFNGDYVDRGAWGLE FL+LLAWKV + R ++ G S Sbjct: 103 ENRFFVFNGDYVDRGAWGLESFLILLAWKVLMPKRVYLLRGNHES 147 >tpg|DAA48032.1| TPA: putative serine/threonine protein phosphatase superfamily protein [Zea mays] Length = 421 Score = 62.8 bits (151), Expect = 5e-08 Identities = 27/30 (90%), Positives = 28/30 (93%) Frame = -2 Query: 314 DDRFFVFNGDYVDRGAWGLEVFLLLLAWKV 225 +DR FVFNGDYVDRGAWGLE FLLLLAWKV Sbjct: 110 EDRIFVFNGDYVDRGAWGLETFLLLLAWKV 139 >tpg|DAA48031.1| TPA: putative serine/threonine protein phosphatase superfamily protein [Zea mays] Length = 519 Score = 62.8 bits (151), Expect = 5e-08 Identities = 27/30 (90%), Positives = 28/30 (93%) Frame = -2 Query: 314 DDRFFVFNGDYVDRGAWGLEVFLLLLAWKV 225 +DR FVFNGDYVDRGAWGLE FLLLLAWKV Sbjct: 312 EDRIFVFNGDYVDRGAWGLETFLLLLAWKV 341 >tpg|DAA48030.1| TPA: putative serine/threonine protein phosphatase superfamily protein [Zea mays] Length = 605 Score = 62.8 bits (151), Expect = 5e-08 Identities = 27/30 (90%), Positives = 28/30 (93%) Frame = -2 Query: 314 DDRFFVFNGDYVDRGAWGLEVFLLLLAWKV 225 +DR FVFNGDYVDRGAWGLE FLLLLAWKV Sbjct: 312 EDRIFVFNGDYVDRGAWGLETFLLLLAWKV 341