BLASTX nr result
ID: Mentha28_contig00033550
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Mentha28_contig00033550 (372 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EYU22831.1| hypothetical protein MIMGU_mgv1a014867mg [Mimulus... 144 1e-32 gb|EYU28235.1| hypothetical protein MIMGU_mgv1a019110mg [Mimulus... 110 3e-22 >gb|EYU22831.1| hypothetical protein MIMGU_mgv1a014867mg [Mimulus guttatus] Length = 175 Score = 144 bits (363), Expect = 1e-32 Identities = 66/125 (52%), Positives = 96/125 (76%), Gaps = 2/125 (1%) Frame = +3 Query: 3 LSLKNFEFS--NFSSQLFSGCPNLETLILAKCSMKPVSKLKVLSFNCLNLKHLEIKRWRS 176 L LK F+FS NF+ LFSGCPNLE+L+L++CS++P ++KVL+ N NL +L IK WRS Sbjct: 26 LHLKKFQFSGNNFNGDLFSGCPNLESLVLSRCSIRPRDEVKVLNLNFSNLVNLVIKCWRS 85 Query: 177 PWRCFDDHVIDLDAPKLAFLKFQGSPVRLNFKEVLLCVESASFELFFPTACAMINVNERM 356 PW CF++H I+++APKLAF K+QG R+NF + LL +E A EL +PTAC ++N++ER Sbjct: 86 PWICFNEHAINVNAPKLAFFKYQGHLARVNFNDSLLFLERACIELCYPTACTIVNLSERK 145 Query: 357 QKISQ 371 Q++++ Sbjct: 146 QELAE 150 >gb|EYU28235.1| hypothetical protein MIMGU_mgv1a019110mg [Mimulus guttatus] Length = 360 Score = 110 bits (274), Expect = 3e-22 Identities = 56/120 (46%), Positives = 78/120 (65%), Gaps = 2/120 (1%) Frame = +3 Query: 3 LSLKNFEFS--NFSSQLFSGCPNLETLILAKCSMKPVSKLKVLSFNCLNLKHLEIKRWRS 176 L LKNFEFS N++ ++F+GCPNLE L+L KC ++ +LKVL NCLNLK LEI+ WRS Sbjct: 175 LHLKNFEFSAKNYNGEVFTGCPNLEELVLVKCLIRCGDELKVLDVNCLNLKKLEIRYWRS 234 Query: 177 PWRCFDDHVIDLDAPKLAFLKFQGSPVRLNFKEVLLCVESASFELFFPTACAMINVNERM 356 PW + +I ++AP L F K QGS R++F+ + C+ A EL P M+ +E + Sbjct: 235 PW----EDMIGVNAPNLEFFKLQGSITRIDFRTDMPCLYRACIELSVPVGEKMMTTSETL 290