BLASTX nr result
ID: Mentha28_contig00033541
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Mentha28_contig00033541 (438 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EPS65268.1| hypothetical protein M569_09510 [Genlisea aurea] 62 8e-08 gb|EYU23846.1| hypothetical protein MIMGU_mgv1a013810mg [Mimulus... 60 2e-07 >gb|EPS65268.1| hypothetical protein M569_09510 [Genlisea aurea] Length = 210 Score = 62.0 bits (149), Expect = 8e-08 Identities = 30/31 (96%), Positives = 31/31 (100%) Frame = -2 Query: 95 MESSSGAAPEFDYLFKLLMIGDSGVGKSSLL 3 MESSSG+APEFDYLFKLLMIGDSGVGKSSLL Sbjct: 1 MESSSGSAPEFDYLFKLLMIGDSGVGKSSLL 31 >gb|EYU23846.1| hypothetical protein MIMGU_mgv1a013810mg [Mimulus guttatus] Length = 210 Score = 60.5 bits (145), Expect = 2e-07 Identities = 29/31 (93%), Positives = 30/31 (96%) Frame = -2 Query: 95 MESSSGAAPEFDYLFKLLMIGDSGVGKSSLL 3 MESSSGA PEFDYLFKLLMIGDSGVGKS+LL Sbjct: 1 MESSSGAVPEFDYLFKLLMIGDSGVGKSTLL 31