BLASTX nr result
ID: Mentha28_contig00033259
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Mentha28_contig00033259 (570 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EPS61767.1| hypothetical protein M569_13026 [Genlisea aurea] 58 2e-06 >gb|EPS61767.1| hypothetical protein M569_13026 [Genlisea aurea] Length = 1004 Score = 57.8 bits (138), Expect = 2e-06 Identities = 21/31 (67%), Positives = 29/31 (93%) Frame = -1 Query: 570 NYSLGQIRDSEGNIKIKKCYCGADGCSGRLY 478 NYS+GQIRD++GN+K+K+C+CGA C+GRLY Sbjct: 974 NYSMGQIRDTDGNVKVKECFCGAASCTGRLY 1004