BLASTX nr result
ID: Mentha28_contig00033213
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Mentha28_contig00033213 (365 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002316665.1| armadillo/beta-catenin repeat family protein... 84 2e-14 ref|XP_006347141.1| PREDICTED: vacuolar protein 8-like [Solanum ... 80 3e-13 ref|XP_004232794.1| PREDICTED: vacuolar protein 8-like [Solanum ... 80 3e-13 ref|XP_007025808.1| ARM repeat superfamily protein [Theobroma ca... 80 4e-13 ref|XP_002305650.1| armadillo/beta-catenin repeat family protein... 80 4e-13 gb|EYU43422.1| hypothetical protein MIMGU_mgv1a003598mg [Mimulus... 77 2e-12 ref|XP_002524688.1| ubiquitin-protein ligase, putative [Ricinus ... 77 2e-12 ref|XP_004504963.1| PREDICTED: uncharacterized protein LOC101501... 75 9e-12 ref|XP_003608254.1| Importin subunit alpha-2 [Medicago truncatul... 75 9e-12 ref|XP_003543090.1| PREDICTED: vacuolar protein 8-like [Glycine ... 75 1e-11 ref|XP_004172778.1| PREDICTED: uncharacterized protein LOC101229... 74 2e-11 ref|XP_004153509.1| PREDICTED: vacuolar protein 8-like, partial ... 74 2e-11 ref|XP_007214661.1| hypothetical protein PRUPE_ppa003268mg [Prun... 73 4e-11 ref|NP_564774.1| armadillo/beta-catenin-like repeat-containing p... 73 4e-11 gb|AAL14389.1| At1g61350/T1F9_16 [Arabidopsis thaliana] 73 4e-11 ref|XP_003545829.1| PREDICTED: vacuolar protein 8-like [Glycine ... 73 5e-11 ref|XP_006467905.1| PREDICTED: uncharacterized protein LOC102630... 72 6e-11 ref|XP_006449205.1| hypothetical protein CICLE_v10014752mg [Citr... 72 6e-11 ref|XP_002888089.1| armadillo/beta-catenin repeat family protein... 72 8e-11 ref|XP_007159243.1| hypothetical protein PHAVU_002G221300g [Phas... 72 1e-10 >ref|XP_002316665.1| armadillo/beta-catenin repeat family protein [Populus trichocarpa] gi|222859730|gb|EEE97277.1| armadillo/beta-catenin repeat family protein [Populus trichocarpa] Length = 557 Score = 84.3 bits (207), Expect = 2e-14 Identities = 40/46 (86%), Positives = 44/46 (95%) Frame = -1 Query: 362 RKKIVSSGYLKNIEKLAEAEVSDAKKIVRKLSSNRFRSVLNVFWHS 225 RKKI SSGYLKNIEKLAEAEVSDAK++VRKLS+NRFRS+LNV WHS Sbjct: 512 RKKIASSGYLKNIEKLAEAEVSDAKRLVRKLSTNRFRSILNVIWHS 557 >ref|XP_006347141.1| PREDICTED: vacuolar protein 8-like [Solanum tuberosum] Length = 576 Score = 80.1 bits (196), Expect = 3e-13 Identities = 40/47 (85%), Positives = 43/47 (91%) Frame = -1 Query: 365 ARKKIVSSGYLKNIEKLAEAEVSDAKKIVRKLSSNRFRSVLNVFWHS 225 ARKKI +SGYL NIEKLAEAEVSDAKKIVRKLSSNRFRS+L+ WHS Sbjct: 530 ARKKIANSGYLINIEKLAEAEVSDAKKIVRKLSSNRFRSILSGIWHS 576 >ref|XP_004232794.1| PREDICTED: vacuolar protein 8-like [Solanum lycopersicum] Length = 576 Score = 80.1 bits (196), Expect = 3e-13 Identities = 40/47 (85%), Positives = 43/47 (91%) Frame = -1 Query: 365 ARKKIVSSGYLKNIEKLAEAEVSDAKKIVRKLSSNRFRSVLNVFWHS 225 ARKKI +SGYL NIEKLAEAEVSDAKKIVRKLSSNRFRS+L+ WHS Sbjct: 530 ARKKIANSGYLINIEKLAEAEVSDAKKIVRKLSSNRFRSILSGIWHS 576 >ref|XP_007025808.1| ARM repeat superfamily protein [Theobroma cacao] gi|508781174|gb|EOY28430.1| ARM repeat superfamily protein [Theobroma cacao] Length = 584 Score = 79.7 bits (195), Expect = 4e-13 Identities = 37/46 (80%), Positives = 44/46 (95%) Frame = -1 Query: 362 RKKIVSSGYLKNIEKLAEAEVSDAKKIVRKLSSNRFRSVLNVFWHS 225 R+KI SSGYLKN+EKLAEAEVSDAK++VRKLS+NRFRS+L+ FWHS Sbjct: 539 RRKIASSGYLKNVEKLAEAEVSDAKRLVRKLSTNRFRSMLSGFWHS 584 >ref|XP_002305650.1| armadillo/beta-catenin repeat family protein [Populus trichocarpa] gi|222848614|gb|EEE86161.1| armadillo/beta-catenin repeat family protein [Populus trichocarpa] Length = 575 Score = 79.7 bits (195), Expect = 4e-13 Identities = 38/46 (82%), Positives = 43/46 (93%) Frame = -1 Query: 362 RKKIVSSGYLKNIEKLAEAEVSDAKKIVRKLSSNRFRSVLNVFWHS 225 RKKI +SGYLKNIEKLAEAEVSDAK++VRKLS+NRFRS+LN WHS Sbjct: 530 RKKIANSGYLKNIEKLAEAEVSDAKRLVRKLSTNRFRSMLNGIWHS 575 >gb|EYU43422.1| hypothetical protein MIMGU_mgv1a003598mg [Mimulus guttatus] Length = 575 Score = 77.4 bits (189), Expect = 2e-12 Identities = 41/48 (85%), Positives = 44/48 (91%), Gaps = 1/48 (2%) Frame = -1 Query: 365 ARKKIVSSGYLKNIEKLA-EAEVSDAKKIVRKLSSNRFRSVLNVFWHS 225 ARKKIVSSG+LKNIEKLA E EVSDAKKIVRKLSS RFR++LN FWHS Sbjct: 528 ARKKIVSSGFLKNIEKLADEDEVSDAKKIVRKLSSGRFRTMLNGFWHS 575 >ref|XP_002524688.1| ubiquitin-protein ligase, putative [Ricinus communis] gi|223536049|gb|EEF37707.1| ubiquitin-protein ligase, putative [Ricinus communis] Length = 573 Score = 77.4 bits (189), Expect = 2e-12 Identities = 36/46 (78%), Positives = 44/46 (95%) Frame = -1 Query: 362 RKKIVSSGYLKNIEKLAEAEVSDAKKIVRKLSSNRFRSVLNVFWHS 225 R+KIV+SGYLKN+EKLAEAEVSDAK++VRKLS+NRFRS+L+ WHS Sbjct: 528 RRKIVNSGYLKNLEKLAEAEVSDAKRLVRKLSTNRFRSMLSGLWHS 573 >ref|XP_004504963.1| PREDICTED: uncharacterized protein LOC101501930 [Cicer arietinum] Length = 577 Score = 75.1 bits (183), Expect = 9e-12 Identities = 38/48 (79%), Positives = 44/48 (91%), Gaps = 1/48 (2%) Frame = -1 Query: 365 ARKKIVSSGYLKNIEKLAEAEV-SDAKKIVRKLSSNRFRSVLNVFWHS 225 ARKKIVSSGY KNI+KLAEAEV SDAKK+V+KLS+NRFR++LN WHS Sbjct: 530 ARKKIVSSGYAKNIDKLAEAEVSSDAKKLVKKLSTNRFRNMLNGIWHS 577 >ref|XP_003608254.1| Importin subunit alpha-2 [Medicago truncatula] gi|355509309|gb|AES90451.1| Importin subunit alpha-2 [Medicago truncatula] Length = 577 Score = 75.1 bits (183), Expect = 9e-12 Identities = 38/48 (79%), Positives = 44/48 (91%), Gaps = 1/48 (2%) Frame = -1 Query: 365 ARKKIVSSGYLKNIEKLAEAEVS-DAKKIVRKLSSNRFRSVLNVFWHS 225 ARKKIVSSGY KNI+KLA+AEVS DAKK+V+KLS+NRFRS+LN WHS Sbjct: 530 ARKKIVSSGYAKNIDKLADAEVSCDAKKLVKKLSTNRFRSMLNGIWHS 577 >ref|XP_003543090.1| PREDICTED: vacuolar protein 8-like [Glycine max] Length = 562 Score = 74.7 bits (182), Expect = 1e-11 Identities = 38/47 (80%), Positives = 43/47 (91%), Gaps = 1/47 (2%) Frame = -1 Query: 362 RKKIVSSGYLKNIEKLAEAEVS-DAKKIVRKLSSNRFRSVLNVFWHS 225 RKKIVSSGY KNIE+LAEAEVS DAK++VRKLS+NRFRS+LN WHS Sbjct: 516 RKKIVSSGYAKNIERLAEAEVSSDAKRLVRKLSTNRFRSMLNGIWHS 562 >ref|XP_004172778.1| PREDICTED: uncharacterized protein LOC101229202 [Cucumis sativus] Length = 580 Score = 74.3 bits (181), Expect = 2e-11 Identities = 35/46 (76%), Positives = 43/46 (93%) Frame = -1 Query: 362 RKKIVSSGYLKNIEKLAEAEVSDAKKIVRKLSSNRFRSVLNVFWHS 225 R+KIV+SGY+KNIEKLAEAEV DAKK+VRKLS+N+FRS+LN W+S Sbjct: 535 RRKIVNSGYMKNIEKLAEAEVYDAKKLVRKLSTNKFRSLLNGIWNS 580 >ref|XP_004153509.1| PREDICTED: vacuolar protein 8-like, partial [Cucumis sativus] Length = 444 Score = 74.3 bits (181), Expect = 2e-11 Identities = 35/46 (76%), Positives = 43/46 (93%) Frame = -1 Query: 362 RKKIVSSGYLKNIEKLAEAEVSDAKKIVRKLSSNRFRSVLNVFWHS 225 R+KIV+SGY+KNIEKLAEAEV DAKK+VRKLS+N+FRS+LN W+S Sbjct: 399 RRKIVNSGYMKNIEKLAEAEVYDAKKLVRKLSTNKFRSLLNGIWNS 444 >ref|XP_007214661.1| hypothetical protein PRUPE_ppa003268mg [Prunus persica] gi|462410526|gb|EMJ15860.1| hypothetical protein PRUPE_ppa003268mg [Prunus persica] Length = 588 Score = 73.2 bits (178), Expect = 4e-11 Identities = 34/46 (73%), Positives = 42/46 (91%) Frame = -1 Query: 362 RKKIVSSGYLKNIEKLAEAEVSDAKKIVRKLSSNRFRSVLNVFWHS 225 R+KI SGYLKNIE+LAEAEVSDAK++V+KLS+NRFRS+L+ WHS Sbjct: 543 RRKIAHSGYLKNIEELAEAEVSDAKRLVKKLSTNRFRSMLSGIWHS 588 >ref|NP_564774.1| armadillo/beta-catenin-like repeat-containing protein [Arabidopsis thaliana] gi|3056595|gb|AAC13906.1|AAC13906 T1F9.16 [Arabidopsis thaliana] gi|18700125|gb|AAL77674.1| At1g61350/T1F9_16 [Arabidopsis thaliana] gi|332195703|gb|AEE33824.1| armadillo/beta-catenin-like repeat-containing protein [Arabidopsis thaliana] Length = 573 Score = 73.2 bits (178), Expect = 4e-11 Identities = 35/47 (74%), Positives = 41/47 (87%) Frame = -1 Query: 365 ARKKIVSSGYLKNIEKLAEAEVSDAKKIVRKLSSNRFRSVLNVFWHS 225 AR+KI SSGYLK+IEKLAE E SDAKK+V+KLS NRFRS+L+ WHS Sbjct: 527 ARRKIASSGYLKSIEKLAETEGSDAKKLVKKLSMNRFRSILSGIWHS 573 >gb|AAL14389.1| At1g61350/T1F9_16 [Arabidopsis thaliana] Length = 573 Score = 73.2 bits (178), Expect = 4e-11 Identities = 35/47 (74%), Positives = 41/47 (87%) Frame = -1 Query: 365 ARKKIVSSGYLKNIEKLAEAEVSDAKKIVRKLSSNRFRSVLNVFWHS 225 AR+KI SSGYLK+IEKLAE E SDAKK+V+KLS NRFRS+L+ WHS Sbjct: 527 ARRKIASSGYLKSIEKLAETEGSDAKKLVKKLSMNRFRSILSGIWHS 573 >ref|XP_003545829.1| PREDICTED: vacuolar protein 8-like [Glycine max] Length = 563 Score = 72.8 bits (177), Expect = 5e-11 Identities = 37/47 (78%), Positives = 43/47 (91%), Gaps = 1/47 (2%) Frame = -1 Query: 362 RKKIVSSGYLKNIEKLAEAEVS-DAKKIVRKLSSNRFRSVLNVFWHS 225 RKKIVSSGY KNIE+LAEAEVS DAK++VRKLS+NRFRS+L+ WHS Sbjct: 517 RKKIVSSGYAKNIERLAEAEVSSDAKRLVRKLSTNRFRSMLSGIWHS 563 >ref|XP_006467905.1| PREDICTED: uncharacterized protein LOC102630595 [Citrus sinensis] Length = 570 Score = 72.4 bits (176), Expect = 6e-11 Identities = 35/47 (74%), Positives = 42/47 (89%) Frame = -1 Query: 365 ARKKIVSSGYLKNIEKLAEAEVSDAKKIVRKLSSNRFRSVLNVFWHS 225 AR+KI +SGYLK IEKLAEAEVSDAK++VRKLS+NRFR +L+ WHS Sbjct: 524 ARRKIANSGYLKIIEKLAEAEVSDAKRLVRKLSTNRFRIMLSGIWHS 570 >ref|XP_006449205.1| hypothetical protein CICLE_v10014752mg [Citrus clementina] gi|557551816|gb|ESR62445.1| hypothetical protein CICLE_v10014752mg [Citrus clementina] Length = 570 Score = 72.4 bits (176), Expect = 6e-11 Identities = 35/47 (74%), Positives = 42/47 (89%) Frame = -1 Query: 365 ARKKIVSSGYLKNIEKLAEAEVSDAKKIVRKLSSNRFRSVLNVFWHS 225 AR+KI +SGYLK IEKLAEAEVSDAK++VRKLS+NRFR +L+ WHS Sbjct: 524 ARRKIANSGYLKIIEKLAEAEVSDAKRLVRKLSTNRFRIMLSGIWHS 570 >ref|XP_002888089.1| armadillo/beta-catenin repeat family protein [Arabidopsis lyrata subsp. lyrata] gi|297333930|gb|EFH64348.1| armadillo/beta-catenin repeat family protein [Arabidopsis lyrata subsp. lyrata] Length = 572 Score = 72.0 bits (175), Expect = 8e-11 Identities = 34/47 (72%), Positives = 41/47 (87%) Frame = -1 Query: 365 ARKKIVSSGYLKNIEKLAEAEVSDAKKIVRKLSSNRFRSVLNVFWHS 225 AR+KI +SGYLK+IEKLAE E SDAKK+V+KLS NRFRS+L+ WHS Sbjct: 526 ARRKIATSGYLKSIEKLAETEGSDAKKLVKKLSRNRFRSILSGIWHS 572 >ref|XP_007159243.1| hypothetical protein PHAVU_002G221300g [Phaseolus vulgaris] gi|561032658|gb|ESW31237.1| hypothetical protein PHAVU_002G221300g [Phaseolus vulgaris] Length = 567 Score = 71.6 bits (174), Expect = 1e-10 Identities = 36/47 (76%), Positives = 43/47 (91%), Gaps = 1/47 (2%) Frame = -1 Query: 362 RKKIVSSGYLKNIEKLAEAEV-SDAKKIVRKLSSNRFRSVLNVFWHS 225 RKKIVSSGY KNIEKLA+AEV SDAK++V+KLS+NRFRS+L+ WHS Sbjct: 521 RKKIVSSGYAKNIEKLADAEVSSDAKRLVKKLSTNRFRSMLSGIWHS 567