BLASTX nr result
ID: Mentha28_contig00033212
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Mentha28_contig00033212 (379 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002309901.2| hypothetical protein POPTR_0007s03920g [Popu... 82 8e-14 gb|EYU18046.1| hypothetical protein MIMGU_mgv1a024177mg [Mimulus... 81 1e-13 ref|XP_007048339.1| Cell wall / vacuolar inhibitor of fructosida... 81 2e-13 gb|EYU23785.1| hypothetical protein MIMGU_mgv1a014666mg [Mimulus... 80 2e-13 gb|EXC33634.1| Pectinesterase inhibitor [Morus notabilis] 79 6e-13 ref|XP_007206622.1| hypothetical protein PRUPE_ppa021753mg [Prun... 79 6e-13 ref|XP_003526858.1| PREDICTED: cell wall / vacuolar inhibitor of... 78 1e-12 ref|XP_006432252.1| hypothetical protein CICLE_v10002604mg [Citr... 78 1e-12 ref|XP_002517248.1| Pectinesterase inhibitor, putative [Ricinus ... 77 2e-12 ref|XP_007137711.1| hypothetical protein PHAVU_009G149400g [Phas... 76 4e-12 ref|NP_001235392.1| uncharacterized protein LOC100306461 precurs... 74 2e-11 ref|XP_004288374.1| PREDICTED: cell wall / vacuolar inhibitor of... 74 3e-11 ref|XP_003602589.1| Pectinesterase inhibitor [Medicago truncatul... 72 6e-11 ref|XP_006350971.1| PREDICTED: cell wall / vacuolar inhibitor of... 72 1e-10 ref|XP_004249898.1| PREDICTED: cell wall / vacuolar inhibitor of... 72 1e-10 ref|XP_004502921.1| PREDICTED: cell wall / vacuolar inhibitor of... 71 2e-10 gb|AFK49543.1| unknown [Lotus japonicus] 70 4e-10 ref|XP_002281472.1| PREDICTED: pectinesterase inhibitor [Vitis v... 69 7e-10 ref|XP_004148650.1| PREDICTED: cell wall / vacuolar inhibitor of... 64 3e-08 ref|NP_201267.1| cell wall / vacuolar inhibitor of fructosidase ... 61 2e-07 >ref|XP_002309901.2| hypothetical protein POPTR_0007s03920g [Populus trichocarpa] gi|550334083|gb|EEE90351.2| hypothetical protein POPTR_0007s03920g [Populus trichocarpa] Length = 263 Score = 82.0 bits (201), Expect = 8e-14 Identities = 36/46 (78%), Positives = 40/46 (86%) Frame = -3 Query: 377 AGDYPNGCRNAFKRSPGLVYPLEIARREEGLKHICDVVLGIIDTLG 240 A DYPN CRNAF+R PGL YP E+ARRE+GLKHICDVVLG+ID LG Sbjct: 217 ASDYPNACRNAFRRYPGLAYPSELARREDGLKHICDVVLGMIDHLG 262 >gb|EYU18046.1| hypothetical protein MIMGU_mgv1a024177mg [Mimulus guttatus] Length = 179 Score = 81.3 bits (199), Expect = 1e-13 Identities = 36/47 (76%), Positives = 39/47 (82%) Frame = -3 Query: 377 AGDYPNGCRNAFKRSPGLVYPLEIARREEGLKHICDVVLGIIDTLGF 237 A DYPN CRN FKR PGL+YP IA RE+G KHICDVVLGIIDTLG+ Sbjct: 133 AADYPNACRNVFKRYPGLIYPAGIALREDGFKHICDVVLGIIDTLGW 179 >ref|XP_007048339.1| Cell wall / vacuolar inhibitor of fructosidase 2 [Theobroma cacao] gi|508700600|gb|EOX92496.1| Cell wall / vacuolar inhibitor of fructosidase 2 [Theobroma cacao] Length = 237 Score = 80.9 bits (198), Expect = 2e-13 Identities = 37/47 (78%), Positives = 39/47 (82%) Frame = -3 Query: 377 AGDYPNGCRNAFKRSPGLVYPLEIARREEGLKHICDVVLGIIDTLGF 237 A +YPN C NAF+R PGLVY EI RREEGLKHICDVVLGIID LGF Sbjct: 191 AAEYPNACHNAFRRYPGLVYTREIVRREEGLKHICDVVLGIIDHLGF 237 >gb|EYU23785.1| hypothetical protein MIMGU_mgv1a014666mg [Mimulus guttatus] Length = 182 Score = 80.5 bits (197), Expect = 2e-13 Identities = 38/47 (80%), Positives = 40/47 (85%) Frame = -3 Query: 377 AGDYPNGCRNAFKRSPGLVYPLEIARREEGLKHICDVVLGIIDTLGF 237 A DYPN CR+AFKR PGLVYP EIA RE+GLK ICDVVLGIID LGF Sbjct: 136 AEDYPNACRDAFKRYPGLVYPPEIAVREDGLKRICDVVLGIIDNLGF 182 >gb|EXC33634.1| Pectinesterase inhibitor [Morus notabilis] Length = 192 Score = 79.0 bits (193), Expect = 6e-13 Identities = 35/47 (74%), Positives = 39/47 (82%) Frame = -3 Query: 377 AGDYPNGCRNAFKRSPGLVYPLEIARREEGLKHICDVVLGIIDTLGF 237 A DYPN C NAF+R PGL YP E+ARRE+GLK ICDVVLGIID LG+ Sbjct: 146 AADYPNSCHNAFRRYPGLPYPTELARREDGLKRICDVVLGIIDNLGW 192 >ref|XP_007206622.1| hypothetical protein PRUPE_ppa021753mg [Prunus persica] gi|462402264|gb|EMJ07821.1| hypothetical protein PRUPE_ppa021753mg [Prunus persica] Length = 181 Score = 79.0 bits (193), Expect = 6e-13 Identities = 35/47 (74%), Positives = 37/47 (78%) Frame = -3 Query: 377 AGDYPNGCRNAFKRSPGLVYPLEIARREEGLKHICDVVLGIIDTLGF 237 A DYPN C NAFKR P L YP E+ARREEGLKHICDV LGIID G+ Sbjct: 135 AADYPNACHNAFKRYPALAYPPELARREEGLKHICDVALGIIDNFGW 181 >ref|XP_003526858.1| PREDICTED: cell wall / vacuolar inhibitor of fructosidase 2 [Glycine max] Length = 179 Score = 78.2 bits (191), Expect = 1e-12 Identities = 34/45 (75%), Positives = 38/45 (84%) Frame = -3 Query: 377 AGDYPNGCRNAFKRSPGLVYPLEIARREEGLKHICDVVLGIIDTL 243 A DYPN C NAFKR PGLVYP ++ARRE+GLKHICDV +GIID L Sbjct: 133 AKDYPNACHNAFKRYPGLVYPRDLARREDGLKHICDVAMGIIDNL 177 >ref|XP_006432252.1| hypothetical protein CICLE_v10002604mg [Citrus clementina] gi|568820235|ref|XP_006464633.1| PREDICTED: cell wall / vacuolar inhibitor of fructosidase 2-like [Citrus sinensis] gi|557534374|gb|ESR45492.1| hypothetical protein CICLE_v10002604mg [Citrus clementina] Length = 186 Score = 77.8 bits (190), Expect = 1e-12 Identities = 34/43 (79%), Positives = 37/43 (86%) Frame = -3 Query: 377 AGDYPNGCRNAFKRSPGLVYPLEIARREEGLKHICDVVLGIID 249 A DYPN C NAF+RSPGL YP E+ARRE+GLK ICDVVLGIID Sbjct: 138 AADYPNACHNAFRRSPGLAYPAELARREDGLKQICDVVLGIID 180 >ref|XP_002517248.1| Pectinesterase inhibitor, putative [Ricinus communis] gi|223543619|gb|EEF45148.1| Pectinesterase inhibitor, putative [Ricinus communis] Length = 184 Score = 77.4 bits (189), Expect = 2e-12 Identities = 33/45 (73%), Positives = 38/45 (84%) Frame = -3 Query: 377 AGDYPNGCRNAFKRSPGLVYPLEIARREEGLKHICDVVLGIIDTL 243 A DYPN C N+F+R PGL YP EIARRE+GL+HICDVVLGI+D L Sbjct: 138 AADYPNACHNSFRRVPGLAYPQEIARREQGLEHICDVVLGIVDVL 182 >ref|XP_007137711.1| hypothetical protein PHAVU_009G149400g [Phaseolus vulgaris] gi|561010798|gb|ESW09705.1| hypothetical protein PHAVU_009G149400g [Phaseolus vulgaris] Length = 178 Score = 76.3 bits (186), Expect = 4e-12 Identities = 33/45 (73%), Positives = 37/45 (82%) Frame = -3 Query: 377 AGDYPNGCRNAFKRSPGLVYPLEIARREEGLKHICDVVLGIIDTL 243 A DYPN C NAFK PGL YPL++ARRE+GLKHICDV +GIID L Sbjct: 132 AKDYPNACHNAFKLYPGLTYPLDLARREDGLKHICDVAMGIIDNL 176 >ref|NP_001235392.1| uncharacterized protein LOC100306461 precursor [Glycine max] gi|255628615|gb|ACU14652.1| unknown [Glycine max] Length = 179 Score = 74.3 bits (181), Expect = 2e-11 Identities = 32/45 (71%), Positives = 36/45 (80%) Frame = -3 Query: 377 AGDYPNGCRNAFKRSPGLVYPLEIARREEGLKHICDVVLGIIDTL 243 A DYPN C NAFKR PGL YP ++A RE+GLKHICDV +GIID L Sbjct: 133 AKDYPNACHNAFKRYPGLAYPRDLASREDGLKHICDVAMGIIDNL 177 >ref|XP_004288374.1| PREDICTED: cell wall / vacuolar inhibitor of fructosidase 2-like [Fragaria vesca subsp. vesca] Length = 184 Score = 73.6 bits (179), Expect = 3e-11 Identities = 33/47 (70%), Positives = 37/47 (78%) Frame = -3 Query: 377 AGDYPNGCRNAFKRSPGLVYPLEIARREEGLKHICDVVLGIIDTLGF 237 A DYPN C NAF+R P LVYP E+ARREE LK IC VVLGIID+ G+ Sbjct: 137 AADYPNACHNAFRRFPALVYPPELARREEALKRICSVVLGIIDSFGW 183 >ref|XP_003602589.1| Pectinesterase inhibitor [Medicago truncatula] gi|355491637|gb|AES72840.1| Pectinesterase inhibitor [Medicago truncatula] Length = 178 Score = 72.4 bits (176), Expect = 6e-11 Identities = 33/45 (73%), Positives = 35/45 (77%) Frame = -3 Query: 377 AGDYPNGCRNAFKRSPGLVYPLEIARREEGLKHICDVVLGIIDTL 243 A DYPN C NAFKR P LVYP E+A RE GLKHICDV +GIID L Sbjct: 131 AKDYPNACYNAFKRVPDLVYPPELATRENGLKHICDVAMGIIDNL 175 >ref|XP_006350971.1| PREDICTED: cell wall / vacuolar inhibitor of fructosidase 2-like [Solanum tuberosum] Length = 187 Score = 71.6 bits (174), Expect = 1e-10 Identities = 31/47 (65%), Positives = 37/47 (78%) Frame = -3 Query: 377 AGDYPNGCRNAFKRSPGLVYPLEIARREEGLKHICDVVLGIIDTLGF 237 A DYPN C N FKR+P L YP ++A RE+G KHICDVVLGI+D LG+ Sbjct: 141 AADYPNVCHNGFKRNPRLDYPTQLAIREDGFKHICDVVLGILDALGW 187 >ref|XP_004249898.1| PREDICTED: cell wall / vacuolar inhibitor of fructosidase 2-like [Solanum lycopersicum] Length = 190 Score = 71.6 bits (174), Expect = 1e-10 Identities = 31/47 (65%), Positives = 37/47 (78%) Frame = -3 Query: 377 AGDYPNGCRNAFKRSPGLVYPLEIARREEGLKHICDVVLGIIDTLGF 237 A DYPN C N FKR+P L YP ++A RE+G KHICDVVLGI+D LG+ Sbjct: 144 AADYPNVCHNGFKRNPRLDYPTQLAIREDGFKHICDVVLGILDALGW 190 >ref|XP_004502921.1| PREDICTED: cell wall / vacuolar inhibitor of fructosidase 2-like [Cicer arietinum] Length = 182 Score = 70.9 bits (172), Expect = 2e-10 Identities = 32/45 (71%), Positives = 34/45 (75%) Frame = -3 Query: 377 AGDYPNGCRNAFKRSPGLVYPLEIARREEGLKHICDVVLGIIDTL 243 A DYPN C NAFKR LVYP E+A RE GLKHICDV +GIID L Sbjct: 135 AKDYPNACHNAFKRVNDLVYPTELANRENGLKHICDVAMGIIDNL 179 >gb|AFK49543.1| unknown [Lotus japonicus] Length = 178 Score = 69.7 bits (169), Expect = 4e-10 Identities = 31/47 (65%), Positives = 36/47 (76%) Frame = -3 Query: 377 AGDYPNGCRNAFKRSPGLVYPLEIARREEGLKHICDVVLGIIDTLGF 237 A DYPN C NAFKR LVYP E+A RE+GL+H+CDV LGIID L + Sbjct: 132 AKDYPNACHNAFKRYSDLVYPPELALREKGLRHVCDVALGIIDNLNW 178 >ref|XP_002281472.1| PREDICTED: pectinesterase inhibitor [Vitis vinifera] gi|147777053|emb|CAN65563.1| hypothetical protein VITISV_007190 [Vitis vinifera] Length = 182 Score = 68.9 bits (167), Expect = 7e-10 Identities = 31/45 (68%), Positives = 35/45 (77%) Frame = -3 Query: 377 AGDYPNGCRNAFKRSPGLVYPLEIARREEGLKHICDVVLGIIDTL 243 A DYPN CRN+FKR P L YP E+ RE+ LKH+CDVVLGIID L Sbjct: 136 AADYPNACRNSFKRCPRLPYPPELGPREDVLKHLCDVVLGIIDLL 180 >ref|XP_004148650.1| PREDICTED: cell wall / vacuolar inhibitor of fructosidase 2-like [Cucumis sativus] gi|449531575|ref|XP_004172761.1| PREDICTED: cell wall / vacuolar inhibitor of fructosidase 2-like [Cucumis sativus] Length = 189 Score = 63.5 bits (153), Expect = 3e-08 Identities = 29/47 (61%), Positives = 35/47 (74%) Frame = -3 Query: 377 AGDYPNGCRNAFKRSPGLVYPLEIARREEGLKHICDVVLGIIDTLGF 237 A DY N CR+AFK P + YP ++ RREEGLK IC VVLGI+D LG+ Sbjct: 143 AADYANVCRDAFKGFPAVSYPTKLGRREEGLKRICRVVLGILDLLGW 189 >ref|NP_201267.1| cell wall / vacuolar inhibitor of fructosidase 2 [Arabidopsis thaliana] gi|75219654|sp|O49603.1|CVIF2_ARATH RecName: Full=Cell wall / vacuolar inhibitor of fructosidase 2; Short=AtC/VIF2; Flags: Precursor gi|2765244|emb|CAA73335.1| invertase inhibitor homologue [Arabidopsis thaliana] gi|10178065|dbj|BAB11429.1| invertase inhibitor homolog [Arabidopsis thaliana] gi|21554624|gb|AAM63637.1| invertase inhibitor homolog [Arabidopsis thaliana] gi|28392992|gb|AAO41931.1| putative invertase inhibitor homolog [Arabidopsis thaliana] gi|28827216|gb|AAO50452.1| putative invertase inhibitor homolog [Arabidopsis thaliana] gi|332010544|gb|AED97927.1| cell wall / vacuolar inhibitor of fructosidase 2 [Arabidopsis thaliana] Length = 180 Score = 60.8 bits (146), Expect = 2e-07 Identities = 28/45 (62%), Positives = 32/45 (71%) Frame = -3 Query: 377 AGDYPNGCRNAFKRSPGLVYPLEIARREEGLKHICDVVLGIIDTL 243 A DYPN CRN F+R GL YP+EI RRE L+ IC VV GI+D L Sbjct: 134 AQDYPNVCRNIFRRVKGLAYPVEIRRREASLRRICGVVSGILDRL 178