BLASTX nr result
ID: Mentha28_contig00033155
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Mentha28_contig00033155 (354 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EYU42563.1| hypothetical protein MIMGU_mgv1a007568mg [Mimulus... 96 5e-18 >gb|EYU42563.1| hypothetical protein MIMGU_mgv1a007568mg [Mimulus guttatus] Length = 403 Score = 95.9 bits (237), Expect = 5e-18 Identities = 52/97 (53%), Positives = 63/97 (64%), Gaps = 6/97 (6%) Frame = -3 Query: 274 ADTYFHSSLPS----NPNISAHSTHTSEVSRNFYSLQQFYN--NSCRSIGAYHHLLHYYS 113 A++YF+S PS +P H ++S NF S Q++N +S RSIGAYH L+ + S Sbjct: 27 ANSYFYSPQPSTNYNSPPTRRRLHHLFDLSGNFGSKNQWHNYSSSIRSIGAYHELIQHSS 86 Query: 112 FSTVASDEKREEPKKSNGYGGDRSWIDVYLPEKARPY 2 FST A D KREE K SN GDRSWIDVYLPE ARPY Sbjct: 87 FSTAAPDGKREESKNSNSNNGDRSWIDVYLPENARPY 123