BLASTX nr result
ID: Mentha28_contig00032763
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Mentha28_contig00032763 (394 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|AEH26473.1| hypothetical protein [uncultured Acidobacteria ba... 64 3e-08 >gb|AEH26473.1| hypothetical protein [uncultured Acidobacteria bacterium A2] Length = 204 Score = 63.5 bits (153), Expect = 3e-08 Identities = 37/85 (43%), Positives = 53/85 (62%), Gaps = 5/85 (5%) Frame = +2 Query: 5 FSIPSGKTVQ---SLKFSIASDNYALVFINGELVDSDPLTWHEAKYWNRVINVDTSVLNT 175 F +P G Q +++ +ASD+ A V+ING+L D+DP+ HE YWN+ I + +L Sbjct: 109 FDLPGGVLDQKGATVRLCVASDDSAEVYINGQLADNDPVPDHEPIYWNQDIEIPAKLLK- 167 Query: 176 DGDNVIAVLVKNQDDWA--FFDLEL 244 G NVIAVLVKN+ + F D+EL Sbjct: 168 PGKNVIAVLVKNKQGSSDLFLDVEL 192