BLASTX nr result
ID: Mentha28_contig00032504
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Mentha28_contig00032504 (430 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EYU35493.1| hypothetical protein MIMGU_mgv1a0102462mg, partia... 71 1e-10 >gb|EYU35493.1| hypothetical protein MIMGU_mgv1a0102462mg, partial [Mimulus guttatus] Length = 130 Score = 71.2 bits (173), Expect = 1e-10 Identities = 33/56 (58%), Positives = 42/56 (75%) Frame = -1 Query: 169 SIHNLQASSTRKNFTELSAVYASRGNRIFVHGAPWVVLRSRRLSVKCAVRFRPCID 2 SIHN+QA+S K+FT+LS +YA RG VH AP V +RRLS++C V+FRPCID Sbjct: 3 SIHNVQANSIWKDFTDLSTIYAPRGKPTLVHAAPRPVSGTRRLSIQCEVKFRPCID 58