BLASTX nr result
ID: Mentha28_contig00032109
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Mentha28_contig00032109 (505 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EYU21839.1| hypothetical protein MIMGU_mgv1a022812mg [Mimulus... 63 5e-11 gb|EYU24428.1| hypothetical protein MIMGU_mgv1a001134mg [Mimulus... 72 1e-10 gb|EYU21838.1| hypothetical protein MIMGU_mgv1a001107mg [Mimulus... 62 2e-10 gb|EYU17666.1| hypothetical protein MIMGU_mgv1a021453mg, partial... 65 1e-08 gb|EYU17661.1| hypothetical protein MIMGU_mgv1a025742mg, partial... 64 2e-08 gb|EYU24432.1| hypothetical protein MIMGU_mgv1a023729mg [Mimulus... 64 2e-08 gb|EYU29927.1| hypothetical protein MIMGU_mgv1a021755mg, partial... 64 3e-08 gb|EYU38161.1| hypothetical protein MIMGU_mgv1a020688mg [Mimulus... 63 4e-08 gb|EYU33966.1| hypothetical protein MIMGU_mgv1a001110mg [Mimulus... 63 4e-08 gb|EYU40384.1| hypothetical protein MIMGU_mgv1a020875mg, partial... 63 5e-08 gb|EYU21837.1| hypothetical protein MIMGU_mgv1a021514mg [Mimulus... 63 5e-08 gb|EYU21830.1| hypothetical protein MIMGU_mgv1a001060mg [Mimulus... 63 5e-08 gb|EYU35738.1| hypothetical protein MIMGU_mgv1a020172mg, partial... 62 6e-08 gb|EYU33970.1| hypothetical protein MIMGU_mgv1a018989mg [Mimulus... 62 6e-08 gb|EYU21848.1| hypothetical protein MIMGU_mgv1a023991mg [Mimulus... 62 6e-08 gb|EYU40389.1| hypothetical protein MIMGU_mgv1a001268mg [Mimulus... 62 8e-08 gb|EYU33968.1| hypothetical protein MIMGU_mgv1a026820mg, partial... 62 8e-08 gb|EYU29513.1| hypothetical protein MIMGU_mgv1a025475mg [Mimulus... 62 8e-08 gb|EYU31599.1| hypothetical protein MIMGU_mgv1a025745mg, partial... 62 1e-07 gb|EYU30149.1| hypothetical protein MIMGU_mgv1a018270mg, partial... 62 1e-07 >gb|EYU21839.1| hypothetical protein MIMGU_mgv1a022812mg [Mimulus guttatus] Length = 872 Score = 62.8 bits (151), Expect(2) = 5e-11 Identities = 34/68 (50%), Positives = 49/68 (72%), Gaps = 4/68 (5%) Frame = -3 Query: 497 AEEYLEELVDRNLLAVE----SGDIETYRIHDLLRDLCLREAQKEKFLCVVGEKTIHDFE 330 + EYLE+L DRNL+ V +G I+ IHDLLR++CLREA++EKFL V + ++ + Sbjct: 446 SREYLEDLCDRNLIRVHQRGSNGKIKFCNIHDLLREVCLREAEREKFLYVPRKHSL-NIA 504 Query: 329 QGISSQRR 306 QGI++QRR Sbjct: 505 QGINTQRR 512 Score = 30.0 bits (66), Expect(2) = 5e-11 Identities = 27/73 (36%), Positives = 32/73 (43%), Gaps = 10/73 (13%) Frame = -1 Query: 199 TGECRSDPLILQSLKSASLVRTLFGKF------PSSNYRLLRVCPTDDGSESS----RDS 50 TG R + +L S L R+L KF P SNYRLLRV D S DS Sbjct: 522 TGYLRDVLQVNNTLLSVPLARSLMCKFMLLPSHPGSNYRLLRVLKVVDKHSYSGYHASDS 581 Query: 49 EQMIDPPVNLRLL 11 + + VN R L Sbjct: 582 IEAVLQLVNSRFL 594 >gb|EYU24428.1| hypothetical protein MIMGU_mgv1a001134mg [Mimulus guttatus] Length = 880 Score = 71.6 bits (174), Expect = 1e-10 Identities = 39/70 (55%), Positives = 49/70 (70%), Gaps = 4/70 (5%) Frame = -3 Query: 503 EAAEEYLEELVDRNLLAV----ESGDIETYRIHDLLRDLCLREAQKEKFLCVVGEKTIHD 336 E AE YL++LVDRNL+ V +G I+T +HDLLRDLCL+ A KEKFL VVG + D Sbjct: 437 EVAEGYLKDLVDRNLIIVGTFGSTGKIKTCHVHDLLRDLCLKTAHKEKFLYVVG---VSD 493 Query: 335 FEQGISSQRR 306 QGI+ +RR Sbjct: 494 SSQGINDERR 503 >gb|EYU21838.1| hypothetical protein MIMGU_mgv1a001107mg [Mimulus guttatus] Length = 888 Score = 62.0 bits (149), Expect(2) = 2e-10 Identities = 34/72 (47%), Positives = 47/72 (65%), Gaps = 4/72 (5%) Frame = -3 Query: 497 AEEYLEELVDRNLLAVES----GDIETYRIHDLLRDLCLREAQKEKFLCVVGEKTIHDFE 330 + EYLEEL DRNL+ V G I+ IHDL+R+LCLREA+KEKFL V +++ Sbjct: 442 SREYLEELCDRNLIRVHQRGSKGRIKYCNIHDLVRELCLREAEKEKFLYVRIPHDLNNVP 501 Query: 329 QGISSQRRFTGM 294 QG+ + +R G+ Sbjct: 502 QGVINTQRRIGI 513 Score = 28.9 bits (63), Expect(2) = 2e-10 Identities = 19/51 (37%), Positives = 28/51 (54%), Gaps = 4/51 (7%) Frame = -1 Query: 184 SDPLILQSLKSASLVRTLFGKF----PSSNYRLLRVCPTDDGSESSRDSEQ 44 S+P L +L+S LVR+L +F P+ ++RLLRV D S + Q Sbjct: 518 SEPEALYALQSMPLVRSLICEFKGVLPTLDFRLLRVLKAVDKHLYSEEKRQ 568 >gb|EYU17666.1| hypothetical protein MIMGU_mgv1a021453mg, partial [Mimulus guttatus] Length = 690 Score = 65.1 bits (157), Expect = 1e-08 Identities = 33/55 (60%), Positives = 42/55 (76%), Gaps = 4/55 (7%) Frame = -3 Query: 503 EAAEEYLEELVDRNLLAVE----SGDIETYRIHDLLRDLCLREAQKEKFLCVVGE 351 E+AE YL++LVDRNL+ V +G ++T IHDLLR+LCL+ AQKEKFLCV E Sbjct: 462 ESAEGYLKDLVDRNLVLVRRLGSTGKMKTCTIHDLLRELCLKVAQKEKFLCVTSE 516 >gb|EYU17661.1| hypothetical protein MIMGU_mgv1a025742mg, partial [Mimulus guttatus] Length = 726 Score = 64.3 bits (155), Expect = 2e-08 Identities = 37/70 (52%), Positives = 48/70 (68%), Gaps = 4/70 (5%) Frame = -3 Query: 503 EAAEEYLEELVDRNLLAVE----SGDIETYRIHDLLRDLCLREAQKEKFLCVVGEKTIHD 336 E AE YL++LVDRNL+AV +G I+T IHDLLRDLCL A+KE+FL V+ + D Sbjct: 282 EVAEGYLKDLVDRNLIAVGRLGWNGKIKTCNIHDLLRDLCLMAARKERFLHVM---DLFD 338 Query: 335 FEQGISSQRR 306 GI ++RR Sbjct: 339 IPGGIDNERR 348 >gb|EYU24432.1| hypothetical protein MIMGU_mgv1a023729mg [Mimulus guttatus] Length = 860 Score = 63.9 bits (154), Expect = 2e-08 Identities = 33/70 (47%), Positives = 47/70 (67%), Gaps = 4/70 (5%) Frame = -3 Query: 503 EAAEEYLEELVDRNLLAVE----SGDIETYRIHDLLRDLCLREAQKEKFLCVVGEKTIHD 336 E AE++L++LVDRNL+ +G +T IHDLLRDLC++ A+KEKFL V+ +H Sbjct: 426 EIAEDHLKDLVDRNLILPRKLRSTGKTKTCTIHDLLRDLCIKAAEKEKFLIVMRVNDVHI 485 Query: 335 FEQGISSQRR 306 +GI +RR Sbjct: 486 NAEGIYKERR 495 >gb|EYU29927.1| hypothetical protein MIMGU_mgv1a021755mg, partial [Mimulus guttatus] Length = 842 Score = 63.5 bits (153), Expect = 3e-08 Identities = 36/78 (46%), Positives = 50/78 (64%), Gaps = 4/78 (5%) Frame = -3 Query: 503 EAAEEYLEELVDRNLLAV----ESGDIETYRIHDLLRDLCLREAQKEKFLCVVGEKTIHD 336 E AE Y+++ VDRNL+ V +G I+T IHDLLRDLCL+ +QKE+FL ++ + D Sbjct: 441 EIAEGYIKDFVDRNLILVCAFGSTGKIKTCNIHDLLRDLCLKTSQKERFLYMM---SASD 497 Query: 335 FEQGISSQRRFTGMFFFP 282 QGI ++RR FP Sbjct: 498 SPQGIENERRIVFHERFP 515 >gb|EYU38161.1| hypothetical protein MIMGU_mgv1a020688mg [Mimulus guttatus] Length = 861 Score = 63.2 bits (152), Expect = 4e-08 Identities = 34/70 (48%), Positives = 47/70 (67%), Gaps = 4/70 (5%) Frame = -3 Query: 503 EAAEEYLEELVDRNLLAVE----SGDIETYRIHDLLRDLCLREAQKEKFLCVVGEKTIHD 336 E E+YL++L DRNL+ V + I+ +HDLLRDLCL++AQ+EKFL V+G + D Sbjct: 431 EIGEDYLKDLTDRNLILVHRYRSTRKIKICLVHDLLRDLCLKKAQEEKFLRVMG---VSD 487 Query: 335 FEQGISSQRR 306 QGI +RR Sbjct: 488 IPQGIDEERR 497 >gb|EYU33966.1| hypothetical protein MIMGU_mgv1a001110mg [Mimulus guttatus] Length = 887 Score = 63.2 bits (152), Expect = 4e-08 Identities = 35/68 (51%), Positives = 46/68 (67%), Gaps = 4/68 (5%) Frame = -3 Query: 497 AEEYLEELVDRNLLAVES----GDIETYRIHDLLRDLCLREAQKEKFLCVVGEKTIHDFE 330 AEEYL +L++RNL+ V + G+I+ IHDLLRDLCLR+AQKE F+CV +H Sbjct: 444 AEEYLNDLIERNLILVHTRGSTGNIKLCNIHDLLRDLCLRQAQKENFVCVT---RLHGIP 500 Query: 329 QGISSQRR 306 Q I + RR Sbjct: 501 Q-IDTHRR 507 >gb|EYU40384.1| hypothetical protein MIMGU_mgv1a020875mg, partial [Mimulus guttatus] Length = 834 Score = 62.8 bits (151), Expect = 5e-08 Identities = 33/52 (63%), Positives = 38/52 (73%), Gaps = 4/52 (7%) Frame = -3 Query: 503 EAAEEYLEELVDRNLLAVE----SGDIETYRIHDLLRDLCLREAQKEKFLCV 360 E AEEYLE+LVDRNL+ V SG ++ IHDLLRDLC REA K+KFL V Sbjct: 439 EVAEEYLEDLVDRNLVLVRKRGLSGKVKACGIHDLLRDLCTREAHKDKFLYV 490 >gb|EYU21837.1| hypothetical protein MIMGU_mgv1a021514mg [Mimulus guttatus] Length = 745 Score = 62.8 bits (151), Expect = 5e-08 Identities = 35/68 (51%), Positives = 48/68 (70%), Gaps = 4/68 (5%) Frame = -3 Query: 497 AEEYLEELVDRNLLAVE----SGDIETYRIHDLLRDLCLREAQKEKFLCVVGEKTIHDFE 330 + EYL+EL DRNL+ V +G+I+ +IHDLLR+LCLREA++EKFL V + Sbjct: 380 SREYLQELCDRNLILVHKRGSNGNIKFCKIHDLLRELCLREAEREKFLYVRRPHEL-TIP 438 Query: 329 QGISSQRR 306 QGI++QRR Sbjct: 439 QGINTQRR 446 >gb|EYU21830.1| hypothetical protein MIMGU_mgv1a001060mg [Mimulus guttatus] Length = 899 Score = 62.8 bits (151), Expect = 5e-08 Identities = 34/68 (50%), Positives = 49/68 (72%), Gaps = 4/68 (5%) Frame = -3 Query: 497 AEEYLEELVDRNLLAVE----SGDIETYRIHDLLRDLCLREAQKEKFLCVVGEKTIHDFE 330 + EYLE+L DRNL+ V +G I+ IHDLLR++CLREA++EKFL V + ++ + Sbjct: 447 SREYLEDLCDRNLIRVHQRGSNGKIKFCNIHDLLREVCLREAEREKFLYVPRKHSL-NIA 505 Query: 329 QGISSQRR 306 QGI++QRR Sbjct: 506 QGINTQRR 513 >gb|EYU35738.1| hypothetical protein MIMGU_mgv1a020172mg, partial [Mimulus guttatus] Length = 647 Score = 62.4 bits (150), Expect = 6e-08 Identities = 37/71 (52%), Positives = 48/71 (67%), Gaps = 6/71 (8%) Frame = -3 Query: 500 AAEEYLEELVDRNLLAVE----SGDIETYRIHDLLRDLCLREAQKEKFLCVVGEKTIHDF 333 AA EYLE+L DRNL+ V +G I+ +IHDL+R+LCLREA+KEKF+ V + HD Sbjct: 335 AAREYLEDLCDRNLILVHQRGLNGGIKFCKIHDLVRELCLREAEKEKFIYV---RRPHDL 391 Query: 332 E--QGISSQRR 306 QGI + RR Sbjct: 392 NIPQGIINTRR 402 >gb|EYU33970.1| hypothetical protein MIMGU_mgv1a018989mg [Mimulus guttatus] Length = 895 Score = 62.4 bits (150), Expect = 6e-08 Identities = 31/50 (62%), Positives = 40/50 (80%), Gaps = 4/50 (8%) Frame = -3 Query: 497 AEEYLEELVDRNLLAVE----SGDIETYRIHDLLRDLCLREAQKEKFLCV 360 AEEYL++L++RNL+ V SG I+ IHDLLRDLCLR+A+KEKF+CV Sbjct: 444 AEEYLKDLIERNLVLVHTRGSSGKIKFCIIHDLLRDLCLRQAEKEKFVCV 493 >gb|EYU21848.1| hypothetical protein MIMGU_mgv1a023991mg [Mimulus guttatus] Length = 905 Score = 62.4 bits (150), Expect = 6e-08 Identities = 37/71 (52%), Positives = 48/71 (67%), Gaps = 6/71 (8%) Frame = -3 Query: 500 AAEEYLEELVDRNLLAVE----SGDIETYRIHDLLRDLCLREAQKEKFLCVVGEKTIHDF 333 AA EYLE+L DRNL+ V +G I+ +IHDL+R+LCLREA+KEKF+ V + HD Sbjct: 463 AAREYLEDLCDRNLILVHQRGLNGGIKFCKIHDLVRELCLREAEKEKFIYV---RRPHDL 519 Query: 332 E--QGISSQRR 306 QGI + RR Sbjct: 520 NIPQGIINTRR 530 >gb|EYU40389.1| hypothetical protein MIMGU_mgv1a001268mg [Mimulus guttatus] Length = 849 Score = 62.0 bits (149), Expect = 8e-08 Identities = 40/87 (45%), Positives = 54/87 (62%), Gaps = 4/87 (4%) Frame = -3 Query: 503 EAAEEYLEELVDRNLLAVE----SGDIETYRIHDLLRDLCLREAQKEKFLCVVGEKTIHD 336 E AEEYLE+L R+L+ V +G I+ +IHDLLRDLCLR+A++E FL V+ E ++ D Sbjct: 435 EVAEEYLEDLAKRSLVLVVKKRFNGRIKAVKIHDLLRDLCLRKAREENFLHVINEFSV-D 493 Query: 335 FEQGISSQRRFTGMFFFPIIVSIFSYI 255 + I RR +SIFSYI Sbjct: 494 SLKVIEKSRR----------LSIFSYI 510 >gb|EYU33968.1| hypothetical protein MIMGU_mgv1a026820mg, partial [Mimulus guttatus] Length = 880 Score = 62.0 bits (149), Expect = 8e-08 Identities = 31/50 (62%), Positives = 39/50 (78%), Gaps = 4/50 (8%) Frame = -3 Query: 497 AEEYLEELVDRNLLAVE----SGDIETYRIHDLLRDLCLREAQKEKFLCV 360 AEEYL +L++RNL+ V SG I+ IHDLLRDLCLR+A+KEKF+CV Sbjct: 437 AEEYLNDLIERNLVLVHIRGSSGKIKFCIIHDLLRDLCLRQAEKEKFVCV 486 >gb|EYU29513.1| hypothetical protein MIMGU_mgv1a025475mg [Mimulus guttatus] Length = 873 Score = 62.0 bits (149), Expect = 8e-08 Identities = 34/70 (48%), Positives = 49/70 (70%), Gaps = 4/70 (5%) Frame = -3 Query: 503 EAAEEYLEELVDRNLLAVES----GDIETYRIHDLLRDLCLREAQKEKFLCVVGEKTIHD 336 + A+EY+++LV+RNLL V + G ++T IHDLLRDLCL+ AQKEKFL ++ + D Sbjct: 409 KVAKEYVKDLVERNLLLVGTLRLNGKMKTCTIHDLLRDLCLKPAQKEKFLYLI---KLCD 465 Query: 335 FEQGISSQRR 306 + GI +RR Sbjct: 466 TQSGIHKERR 475 >gb|EYU31599.1| hypothetical protein MIMGU_mgv1a025745mg, partial [Mimulus guttatus] Length = 692 Score = 61.6 bits (148), Expect = 1e-07 Identities = 37/70 (52%), Positives = 47/70 (67%), Gaps = 6/70 (8%) Frame = -3 Query: 497 AEEYLEELVDRNLLAVES----GDIETYRIHDLLRDLCLREAQKEKFLCVVGEKTIHD-- 336 + EYL+EL DRNL+ V G+I+ +IHDLLR+LCLREA+KEKFL V K H+ Sbjct: 300 SREYLQELCDRNLILVHERGSYGNIKFCKIHDLLRELCLREAEKEKFLYV---KRPHELT 356 Query: 335 FEQGISSQRR 306 GIS+ RR Sbjct: 357 IPYGISTHRR 366 >gb|EYU30149.1| hypothetical protein MIMGU_mgv1a018270mg, partial [Mimulus guttatus] Length = 727 Score = 61.6 bits (148), Expect = 1e-07 Identities = 35/85 (41%), Positives = 53/85 (62%), Gaps = 4/85 (4%) Frame = -3 Query: 503 EAAEEYLEELVDRNLLAVE---SGDIETYRIHDLLRDLCLREAQKEKFLCVVGEKTIHDF 333 + AEEYLE+L+DR+L+ E +G + T RIHDL+R+ CLR+A+KE F V+ + + Sbjct: 273 KVAEEYLEDLIDRSLILAEKRINGRVSTCRIHDLVREFCLRQAEKENFWYVMRRRDLLS- 331 Query: 332 EQGISSQRRF-TGMFFFPIIVSIFS 261 +G+ + RR FP VS +S Sbjct: 332 PEGLQNHRRLCVHSDIFPYAVSEYS 356