BLASTX nr result
ID: Mentha28_contig00032038
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Mentha28_contig00032038 (387 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EYU34646.1| hypothetical protein MIMGU_mgv1a000582mg [Mimulus... 96 7e-18 ref|XP_002323869.2| pentatricopeptide repeat-containing family p... 88 1e-15 ref|XP_007217362.1| hypothetical protein PRUPE_ppa021574mg [Prun... 88 1e-15 ref|XP_004233926.1| PREDICTED: pentatricopeptide repeat-containi... 84 2e-14 ref|XP_002871658.1| pentatricopeptide repeat-containing protein ... 84 2e-14 emb|CBI22241.3| unnamed protein product [Vitis vinifera] 84 2e-14 ref|XP_002278558.1| PREDICTED: pentatricopeptide repeat-containi... 84 2e-14 ref|XP_006431198.1| hypothetical protein CICLE_v10013587mg, part... 82 1e-13 ref|XP_006286917.1| hypothetical protein CARUB_v10000061mg [Caps... 80 2e-13 ref|XP_002533116.1| pentatricopeptide repeat-containing protein,... 80 2e-13 gb|EXB31946.1| hypothetical protein L484_013578 [Morus notabilis] 80 3e-13 ref|XP_004306132.1| PREDICTED: pentatricopeptide repeat-containi... 80 3e-13 ref|NP_197032.1| pentatricopeptide repeat-containing protein [Ar... 80 4e-13 ref|XP_006400048.1| hypothetical protein EUTSA_v10012473mg [Eutr... 79 5e-13 ref|XP_006482624.1| PREDICTED: pentatricopeptide repeat-containi... 79 7e-13 ref|XP_007146506.1| hypothetical protein PHAVU_006G046500g [Phas... 77 3e-12 ref|XP_007146505.1| hypothetical protein PHAVU_006G046500g [Phas... 77 3e-12 ref|XP_004163793.1| PREDICTED: pentatricopeptide repeat-containi... 73 5e-11 ref|XP_004139757.1| PREDICTED: pentatricopeptide repeat-containi... 73 5e-11 ref|XP_003553062.1| PREDICTED: pentatricopeptide repeat-containi... 71 1e-10 >gb|EYU34646.1| hypothetical protein MIMGU_mgv1a000582mg [Mimulus guttatus] Length = 1059 Score = 95.5 bits (236), Expect = 7e-18 Identities = 45/78 (57%), Positives = 57/78 (73%), Gaps = 4/78 (5%) Frame = -2 Query: 386 ETPSRDAFNCLISRYRSENNVSKTSELLILMQQKGYEPDFDTHWSVISNLSHSSKKEG-- 213 E PSR FN +I +YRS+ N KT E++ LMQ+KGY PDF+THWS++SNLS S KK+G Sbjct: 979 EIPSRRVFNAVIDKYRSDKNFGKTFEIVNLMQEKGYVPDFETHWSLVSNLSDSRKKDGGK 1038 Query: 212 --SSFLSNILSGFGFARK 165 FLSN+L GFGF+ K Sbjct: 1039 TSKGFLSNLLEGFGFSAK 1056 >ref|XP_002323869.2| pentatricopeptide repeat-containing family protein [Populus trichocarpa] gi|550320105|gb|EEF04002.2| pentatricopeptide repeat-containing family protein [Populus trichocarpa] Length = 1255 Score = 87.8 bits (216), Expect = 1e-15 Identities = 44/78 (56%), Positives = 56/78 (71%), Gaps = 4/78 (5%) Frame = -2 Query: 386 ETPSRDAFNCLISRYRSENNVSKTSELLILMQQKGYEPDFDTHWSVISNLSHSSKKE--- 216 ETP+R + +I YR ENN K SEL+ +MQQ GYEPDFDTHWS+ISNLS+SS K+ Sbjct: 1170 ETPTRLMYCSVIDGYRMENNPRKASELMQMMQQSGYEPDFDTHWSLISNLSNSSDKDYNK 1229 Query: 215 -GSSFLSNILSGFGFARK 165 FLS++L+G GF+ K Sbjct: 1230 SSQGFLSSLLAGSGFSSK 1247 >ref|XP_007217362.1| hypothetical protein PRUPE_ppa021574mg [Prunus persica] gi|462413512|gb|EMJ18561.1| hypothetical protein PRUPE_ppa021574mg [Prunus persica] Length = 994 Score = 87.8 bits (216), Expect = 1e-15 Identities = 42/82 (51%), Positives = 62/82 (75%), Gaps = 4/82 (4%) Frame = -2 Query: 386 ETPSRDAFNCLISRYRSENNVSKTSELLILMQQKGYEPDFDTHWSVISNLSHSSKKEGSS 207 ET SR+ ++ +I+RYR E N+ KTSEL+ MQQ G+EPDF+THWS+ISNLS+SS K+ ++ Sbjct: 909 ETVSREIYSSVINRYRLEKNLRKTSELMQAMQQSGFEPDFETHWSLISNLSNSSDKDNAN 968 Query: 206 ----FLSNILSGFGFARKTNPR 153 FL+ +LS GF+R+ + + Sbjct: 969 SSRGFLARLLSSSGFSRQKDSK 990 >ref|XP_004233926.1| PREDICTED: pentatricopeptide repeat-containing protein At5g15280-like [Solanum lycopersicum] Length = 1237 Score = 84.0 bits (206), Expect = 2e-14 Identities = 42/79 (53%), Positives = 55/79 (69%), Gaps = 5/79 (6%) Frame = -2 Query: 386 ETPSRDAFNCLISRYRSENNVSKTSELLILMQQKGYEPDFDTHWSVISNLSHSSK----- 222 E P R+ ++ LI+ YRS+NN++K SELL MQ+ GYEPDF+THWS+ISNL SS Sbjct: 1158 EIPRRETYSLLINMYRSQNNLNKASELLRSMQRCGYEPDFETHWSLISNLRDSSDNVNDG 1217 Query: 221 KEGSSFLSNILSGFGFARK 165 K+ FLS L+ GF+RK Sbjct: 1218 KQNGRFLSRFLTEIGFSRK 1236 >ref|XP_002871658.1| pentatricopeptide repeat-containing protein [Arabidopsis lyrata subsp. lyrata] gi|297317495|gb|EFH47917.1| pentatricopeptide repeat-containing protein [Arabidopsis lyrata subsp. lyrata] Length = 1223 Score = 84.0 bits (206), Expect = 2e-14 Identities = 42/78 (53%), Positives = 55/78 (70%), Gaps = 4/78 (5%) Frame = -2 Query: 386 ETPSRDAFNCLISRYRSENNVSKTSELLILMQQKGYEPDFDTHWSVISNLSHSSKKE--- 216 ETPS++ F +I R+R ENN K SE++ +MQ+ GYE DF+THWS+ISNLS +K+ Sbjct: 1145 ETPSQEMFKTVIDRFRVENNTVKASEMMEMMQKCGYEVDFETHWSLISNLSSCKEKKTTT 1204 Query: 215 -GSSFLSNILSGFGFARK 165 G FLS +LSG GFA K Sbjct: 1205 VGEGFLSRLLSGNGFAWK 1222 >emb|CBI22241.3| unnamed protein product [Vitis vinifera] Length = 1256 Score = 84.0 bits (206), Expect = 2e-14 Identities = 42/75 (56%), Positives = 55/75 (73%), Gaps = 2/75 (2%) Frame = -2 Query: 386 ETPSRDAFNCLISRYRSENNVSKTSELLILMQQKGYEPDFDTHWSVISNLSHSSKKEGSS 207 ETP+R+ + LI+R RSENN+SK SELL MQ G+ PDF THWS+ISNL+ S K+ ++ Sbjct: 1175 ETPTREMYTSLINRLRSENNLSKASELLQAMQLSGHAPDFGTHWSLISNLNRSKDKDSAN 1234 Query: 206 --FLSNILSGFGFAR 168 FLS +LS GF+R Sbjct: 1235 RGFLSRLLSESGFSR 1249 >ref|XP_002278558.1| PREDICTED: pentatricopeptide repeat-containing protein At5g15280-like [Vitis vinifera] Length = 1273 Score = 84.0 bits (206), Expect = 2e-14 Identities = 42/75 (56%), Positives = 55/75 (73%), Gaps = 2/75 (2%) Frame = -2 Query: 386 ETPSRDAFNCLISRYRSENNVSKTSELLILMQQKGYEPDFDTHWSVISNLSHSSKKEGSS 207 ETP+R+ + LI+R RSENN+SK SELL MQ G+ PDF THWS+ISNL+ S K+ ++ Sbjct: 1192 ETPTREMYTSLINRLRSENNLSKASELLQAMQLSGHAPDFGTHWSLISNLNRSKDKDSAN 1251 Query: 206 --FLSNILSGFGFAR 168 FLS +LS GF+R Sbjct: 1252 RGFLSRLLSESGFSR 1266 >ref|XP_006431198.1| hypothetical protein CICLE_v10013587mg, partial [Citrus clementina] gi|557533255|gb|ESR44438.1| hypothetical protein CICLE_v10013587mg, partial [Citrus clementina] Length = 1231 Score = 81.6 bits (200), Expect = 1e-13 Identities = 37/77 (48%), Positives = 55/77 (71%), Gaps = 4/77 (5%) Frame = -2 Query: 386 ETPSRDAFNCLISRYRSENNVSKTSELLILMQQKGYEPDFDTHWSVISNLSHSSKKEGS- 210 +TP+++ ++ +++RY ENN+ K SEL+ MQQ GY PDF THWS+ISNL +S+ K+ + Sbjct: 1152 DTPTQEMYSSVVNRYSLENNLGKASELMQAMQQSGYSPDFSTHWSLISNLRNSNDKDNNR 1211 Query: 209 ---SFLSNILSGFGFAR 168 FLS +LSG GF + Sbjct: 1212 NSQGFLSRLLSGSGFIK 1228 >ref|XP_006286917.1| hypothetical protein CARUB_v10000061mg [Capsella rubella] gi|482555623|gb|EOA19815.1| hypothetical protein CARUB_v10000061mg [Capsella rubella] Length = 1230 Score = 80.5 bits (197), Expect = 2e-13 Identities = 39/77 (50%), Positives = 55/77 (71%), Gaps = 3/77 (3%) Frame = -2 Query: 386 ETPSRDAFNCLISRYRSENNVSKTSELLILMQQKGYEPDFDTHWSVISNLSHSSKKE--- 216 ETPS++ F +I ++R ENN K SE++ +MQ+ GYE DF+THWS+ISN+S + +K+ Sbjct: 1153 ETPSQEMFKLVIDQFRVENNTVKASEMMEMMQKCGYEIDFETHWSLISNMSTAKEKKTTA 1212 Query: 215 GSSFLSNILSGFGFARK 165 G FLS +LSG GF K Sbjct: 1213 GEGFLSRLLSGNGFTWK 1229 >ref|XP_002533116.1| pentatricopeptide repeat-containing protein, putative [Ricinus communis] gi|223527079|gb|EEF29261.1| pentatricopeptide repeat-containing protein, putative [Ricinus communis] Length = 1204 Score = 80.5 bits (197), Expect = 2e-13 Identities = 40/88 (45%), Positives = 55/88 (62%), Gaps = 10/88 (11%) Frame = -2 Query: 386 ETPSRDAFNCLISRYRSENNVSKTSELLILMQQKGYEPDFDTHWSVISNLSHSSKKEGS- 210 ETP ++ +I+RYR ENN K S+L+ +MQ+ GYEPDFDTHWS+ISNL K+ + Sbjct: 1113 ETPPGKMYSTVINRYRFENNPRKASQLMQMMQRNGYEPDFDTHWSLISNLQKFKDKDNNQ 1172 Query: 209 ---------SFLSNILSGFGFARKTNPR 153 FL+ +LSG GF+ K + R Sbjct: 1173 EERNNNSSQGFLARLLSGSGFSNKKDSR 1200 >gb|EXB31946.1| hypothetical protein L484_013578 [Morus notabilis] Length = 1087 Score = 80.1 bits (196), Expect = 3e-13 Identities = 38/82 (46%), Positives = 55/82 (67%), Gaps = 4/82 (4%) Frame = -2 Query: 386 ETPSRDAFNCLISRYRSENNVSKTSELLILMQQKGYEPDFDTHWSVISNL----SHSSKK 219 E P+R+ F+ +I RY ENN K L+ +MQ+ GYEPDF+THWS+I+ L + S+ + Sbjct: 1004 EMPTREMFSSVIDRYHHENNPRKAMGLMEMMQRSGYEPDFETHWSLINKLRTSFNKSNNE 1063 Query: 218 EGSSFLSNILSGFGFARKTNPR 153 G FLS +LS GF+RKT+ + Sbjct: 1064 SGQGFLSRLLSESGFSRKTDSK 1085 >ref|XP_004306132.1| PREDICTED: pentatricopeptide repeat-containing protein At5g15280-like [Fragaria vesca subsp. vesca] Length = 1246 Score = 80.1 bits (196), Expect = 3e-13 Identities = 40/78 (51%), Positives = 55/78 (70%), Gaps = 4/78 (5%) Frame = -2 Query: 386 ETPSRDAFNCLISRYRSENNVSKTSELLILMQQKGYEPDFDTHWSVISNLSHSSKKEGSS 207 ET + + +I+RYRSENN+ K SEL+ MQQ GYEPDF++HWS+I NL SS K+ ++ Sbjct: 1161 ETVTMKIYLSVINRYRSENNLGKVSELMQAMQQSGYEPDFESHWSLIRNLRLSSDKDNAN 1220 Query: 206 ----FLSNILSGFGFARK 165 FLS +LS GF+R+ Sbjct: 1221 SSKGFLSKLLSASGFSRQ 1238 >ref|NP_197032.1| pentatricopeptide repeat-containing protein [Arabidopsis thaliana] gi|75180846|sp|Q9LXF4.1|PP384_ARATH RecName: Full=Pentatricopeptide repeat-containing protein At5g15280 gi|7671497|emb|CAB89338.1| putative protein [Arabidopsis thaliana] gi|332004760|gb|AED92143.1| pentatricopeptide repeat-containing protein [Arabidopsis thaliana] Length = 1227 Score = 79.7 bits (195), Expect = 4e-13 Identities = 39/78 (50%), Positives = 54/78 (69%), Gaps = 4/78 (5%) Frame = -2 Query: 386 ETPSRDAFNCLISRYRSENNVSKTSELLILMQQKGYEPDFDTHWSVISNLSHSSKKE--- 216 E+PS++ F +I R+R E N K SE++ +MQ+ GYE DF+THWS+ISN+S S +K+ Sbjct: 1149 ESPSQEMFKTVIDRFRVEKNTVKASEMMEMMQKCGYEVDFETHWSLISNMSSSKEKKTTT 1208 Query: 215 -GSSFLSNILSGFGFARK 165 G FLS +LSG GF K Sbjct: 1209 AGEGFLSRLLSGNGFTWK 1226 >ref|XP_006400048.1| hypothetical protein EUTSA_v10012473mg [Eutrema salsugineum] gi|557101138|gb|ESQ41501.1| hypothetical protein EUTSA_v10012473mg [Eutrema salsugineum] Length = 1222 Score = 79.3 bits (194), Expect = 5e-13 Identities = 39/76 (51%), Positives = 53/76 (69%), Gaps = 2/76 (2%) Frame = -2 Query: 386 ETPSRDAFNCLISRYRSENNVSKTSELLILMQQKGYEPDFDTHWSVISNLS--HSSKKEG 213 ETPS++ F +I R+R E N K +E++ +MQ+ GYE DF+THWS+ISN+S +K G Sbjct: 1146 ETPSQEMFKTVIDRFRVEKNTVKATEMMEMMQKCGYEIDFETHWSLISNMSSCKENKTAG 1205 Query: 212 SSFLSNILSGFGFARK 165 FLS +LSG GFA K Sbjct: 1206 QGFLSRLLSGNGFAWK 1221 >ref|XP_006482624.1| PREDICTED: pentatricopeptide repeat-containing protein At5g15280-like [Citrus sinensis] Length = 1259 Score = 79.0 bits (193), Expect = 7e-13 Identities = 35/77 (45%), Positives = 55/77 (71%), Gaps = 4/77 (5%) Frame = -2 Query: 386 ETPSRDAFNCLISRYRSENNVSKTSELLILMQQKGYEPDFDTHWSVISNLSHSSKKEGS- 210 +TP+++ ++ +++RY ENN+ K S+L+ MQQ GY PDF THWS+ISNL +S+ ++ + Sbjct: 1183 DTPTQEMYSSVVNRYSLENNLGKASDLMQAMQQSGYSPDFSTHWSLISNLRNSNDEDNNR 1242 Query: 209 ---SFLSNILSGFGFAR 168 FLS +LSG GF + Sbjct: 1243 NSQGFLSRLLSGSGFIK 1259 >ref|XP_007146506.1| hypothetical protein PHAVU_006G046500g [Phaseolus vulgaris] gi|561019729|gb|ESW18500.1| hypothetical protein PHAVU_006G046500g [Phaseolus vulgaris] Length = 1189 Score = 76.6 bits (187), Expect = 3e-12 Identities = 37/78 (47%), Positives = 51/78 (65%), Gaps = 4/78 (5%) Frame = -2 Query: 386 ETPSRDAFNCLISRYRSENNVSKTSELLILMQQKGYEPDFDTHWSVISNLSHSSKKE--- 216 ETP+R + +I Y E N+ K SEL+ MQ+ GY+PDF+THWS+ISNL+ + K+ Sbjct: 1111 ETPTRKMYCTVIKSYHMEKNLRKASELMQAMQENGYQPDFETHWSLISNLNSAKAKDTDN 1170 Query: 215 -GSSFLSNILSGFGFARK 165 G FLS +LS GF +K Sbjct: 1171 GGKGFLSRLLSKSGFLQK 1188 >ref|XP_007146505.1| hypothetical protein PHAVU_006G046500g [Phaseolus vulgaris] gi|561019728|gb|ESW18499.1| hypothetical protein PHAVU_006G046500g [Phaseolus vulgaris] Length = 859 Score = 76.6 bits (187), Expect = 3e-12 Identities = 37/78 (47%), Positives = 51/78 (65%), Gaps = 4/78 (5%) Frame = -2 Query: 386 ETPSRDAFNCLISRYRSENNVSKTSELLILMQQKGYEPDFDTHWSVISNLSHSSKKE--- 216 ETP+R + +I Y E N+ K SEL+ MQ+ GY+PDF+THWS+ISNL+ + K+ Sbjct: 781 ETPTRKMYCTVIKSYHMEKNLRKASELMQAMQENGYQPDFETHWSLISNLNSAKAKDTDN 840 Query: 215 -GSSFLSNILSGFGFARK 165 G FLS +LS GF +K Sbjct: 841 GGKGFLSRLLSKSGFLQK 858 >ref|XP_004163793.1| PREDICTED: pentatricopeptide repeat-containing protein At5g15280-like [Cucumis sativus] Length = 1225 Score = 72.8 bits (177), Expect = 5e-11 Identities = 36/83 (43%), Positives = 54/83 (65%), Gaps = 6/83 (7%) Frame = -2 Query: 386 ETPSRDAFNCLISRYRSENNVSKTSELLILMQQKGYEPDFDTHWSVISNLSHSSKKEGSS 207 E PS+DA+ ++ RYR ENN+ K SE + MQ+ GYE DF+T WS+IS L+ ++ K+ ++ Sbjct: 1143 EKPSKDAYCSMLDRYRYENNLEKASETMKAMQESGYELDFETQWSLISKLNDTNLKDSNN 1202 Query: 206 ------FLSNILSGFGFARKTNP 156 FL+ +LS GF+R P Sbjct: 1203 SNSNKGFLAGLLSKSGFSRALIP 1225 >ref|XP_004139757.1| PREDICTED: pentatricopeptide repeat-containing protein At5g15280-like [Cucumis sativus] Length = 1246 Score = 72.8 bits (177), Expect = 5e-11 Identities = 36/83 (43%), Positives = 54/83 (65%), Gaps = 6/83 (7%) Frame = -2 Query: 386 ETPSRDAFNCLISRYRSENNVSKTSELLILMQQKGYEPDFDTHWSVISNLSHSSKKEGSS 207 E PS+DA+ ++ RYR ENN+ K SE + MQ+ GYE DF+T WS+IS L+ ++ K+ ++ Sbjct: 1164 EKPSKDAYCSMLDRYRYENNLEKASETMKAMQESGYELDFETQWSLISKLNDTNLKDSNN 1223 Query: 206 ------FLSNILSGFGFARKTNP 156 FL+ +LS GF+R P Sbjct: 1224 SNSNKGFLAGLLSKSGFSRALIP 1246 >ref|XP_003553062.1| PREDICTED: pentatricopeptide repeat-containing protein At5g15280-like [Glycine max] Length = 1186 Score = 71.2 bits (173), Expect = 1e-10 Identities = 35/78 (44%), Positives = 49/78 (62%), Gaps = 4/78 (5%) Frame = -2 Query: 386 ETPSRDAFNCLISRYRSENNVSKTSELLILMQQKGYEPDFDTHWSVISNLSHSSKKE--- 216 ETP+R + +I Y + N+ K SELL MQ+ GY+PDF+THWS+ISNL+ + K+ Sbjct: 1108 ETPTRKMYCTVIKSYHMKKNLRKASELLQAMQENGYQPDFETHWSLISNLNSAKAKDTDN 1167 Query: 215 -GSSFLSNILSGFGFARK 165 FLS +L GF +K Sbjct: 1168 ASKGFLSRLLFKSGFLQK 1185