BLASTX nr result
ID: Mentha28_contig00031837
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Mentha28_contig00031837 (325 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EYU29870.1| hypothetical protein MIMGU_mgv1a026869mg [Mimulus... 60 4e-07 >gb|EYU29870.1| hypothetical protein MIMGU_mgv1a026869mg [Mimulus guttatus] Length = 106 Score = 59.7 bits (143), Expect = 4e-07 Identities = 30/62 (48%), Positives = 37/62 (59%) Frame = -3 Query: 323 KGQFAVLTVDDGILRRSVMELIYLTHPGXXXXXXXXXXXXXXEQMGVLVIPCTYSHLQSV 144 +G FAV TVD G+L+R V+E+ YL HP Q+GVL IPCTYS LQS+ Sbjct: 45 EGYFAVHTVDGGVLKRFVIEISYLGHPKFLKLLEQAEEEFGFAQIGVLAIPCTYSDLQSI 104 Query: 143 TG 138 G Sbjct: 105 VG 106