BLASTX nr result
ID: Mentha28_contig00031788
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Mentha28_contig00031788 (513 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_006437821.1| hypothetical protein CICLE_v10033630mg, part... 67 2e-09 gb|EXB44932.1| hypothetical protein L484_026520 [Morus notabilis] 58 1e-06 >ref|XP_006437821.1| hypothetical protein CICLE_v10033630mg, partial [Citrus clementina] gi|557540017|gb|ESR51061.1| hypothetical protein CICLE_v10033630mg, partial [Citrus clementina] Length = 98 Score = 67.4 bits (163), Expect = 2e-09 Identities = 32/60 (53%), Positives = 42/60 (70%) Frame = -2 Query: 473 DLIFLVGIAAALTLLNLRYQYINGNPVPILFFHNKPTLFHLFLVALNFGFTASVMTMSLR 294 +LI IA L L+ L Y+ I+GNPVP + F N+P LFH F++ALNF F SV+T+SLR Sbjct: 1 ELILGFSIATTLVLVKLPYEKIDGNPVPTVIFKNRPGLFHAFILALNFSFFGSVLTISLR 60 >gb|EXB44932.1| hypothetical protein L484_026520 [Morus notabilis] Length = 150 Score = 58.2 bits (139), Expect = 1e-06 Identities = 28/69 (40%), Positives = 42/69 (60%) Frame = -2 Query: 488 PKIVEDLIFLVGIAAALTLLNLRYQYINGNPVPILFFHNKPTLFHLFLVALNFGFTASVM 309 P +E++I V IA AL LL L Y+ N P+P + F+ +P+ FH F++ALNF S + Sbjct: 8 PTELEEVILWVSIAMALALLLLPYEDTNERPLPAIIFNGQPSSFHAFILALNFALFGSFL 67 Query: 308 TMSLRATSP 282 + LR + P Sbjct: 68 AIILRRSGP 76