BLASTX nr result
ID: Mentha28_contig00031611
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Mentha28_contig00031611 (506 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|YP_008992281.1| hypothetical protein Salmi_Mp015 (mitochondr... 60 4e-07 >ref|YP_008992281.1| hypothetical protein Salmi_Mp015 (mitochondrion) [Salvia miltiorrhiza] gi|534292257|gb|AGU16549.1| hypothetical protein Salmi_Mp015 (mitochondrion) [Salvia miltiorrhiza] Length = 106 Score = 59.7 bits (143), Expect = 4e-07 Identities = 30/45 (66%), Positives = 33/45 (73%) Frame = -3 Query: 135 RNIMISLTEVNSKEKRKTISDSGTHGQAERNSYALAKRMGPTDQF 1 R ++S SKEKRKT+SDSGTH QA RNSYALAK GP DQF Sbjct: 41 RKELLSGIREGSKEKRKTVSDSGTHEQAGRNSYALAKGTGPIDQF 85