BLASTX nr result
ID: Mentha28_contig00031343
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Mentha28_contig00031343 (594 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_007038728.1| Ribosomal RNA small subunit methyltransferas... 67 3e-09 ref|XP_006421955.1| hypothetical protein CICLE_v10006392mg [Citr... 66 6e-09 ref|XP_007131352.1| hypothetical protein PHAVU_011G006600g [Phas... 65 2e-08 ref|XP_002513686.1| conserved hypothetical protein [Ricinus comm... 64 4e-08 ref|XP_002298135.2| hypothetical protein POPTR_0001s17870g, part... 63 7e-08 ref|XP_003592261.1| hypothetical protein MTR_1g100890 [Medicago ... 62 2e-07 ref|XP_003576875.1| PREDICTED: uncharacterized protein LOC100826... 56 9e-06 >ref|XP_007038728.1| Ribosomal RNA small subunit methyltransferase E [Theobroma cacao] gi|508775973|gb|EOY23229.1| Ribosomal RNA small subunit methyltransferase E [Theobroma cacao] Length = 92 Score = 67.4 bits (163), Expect = 3e-09 Identities = 39/69 (56%), Positives = 44/69 (63%) Frame = +3 Query: 87 KLHSLITFLNLGA*MFQKMGGNGEINTTSTSSSDSVRKIMSACDVEALKKCLEENKGDQT 266 +LHS FL++ FQKM EIN V+KI S CDVEALKKCLEENKGD Sbjct: 13 RLHS---FLHVQTRAFQKMDEKREIN--------GVKKIQSPCDVEALKKCLEENKGDYV 61 Query: 267 KCRSQIEAF 293 KC+ QIEAF Sbjct: 62 KCQYQIEAF 70 >ref|XP_006421955.1| hypothetical protein CICLE_v10006392mg [Citrus clementina] gi|557523828|gb|ESR35195.1| hypothetical protein CICLE_v10006392mg [Citrus clementina] Length = 66 Score = 66.2 bits (160), Expect = 6e-09 Identities = 30/40 (75%), Positives = 34/40 (85%) Frame = +3 Query: 174 TSSSDSVRKIMSACDVEALKKCLEENKGDQTKCRSQIEAF 293 T+ S+ +KIMS CDVEALKKCLEENKGD KC+SQIEAF Sbjct: 4 TAESNGAKKIMSPCDVEALKKCLEENKGDYVKCQSQIEAF 43 >ref|XP_007131352.1| hypothetical protein PHAVU_011G006600g [Phaseolus vulgaris] gi|561004352|gb|ESW03346.1| hypothetical protein PHAVU_011G006600g [Phaseolus vulgaris] Length = 62 Score = 64.7 bits (156), Expect = 2e-08 Identities = 30/37 (81%), Positives = 33/37 (89%) Frame = +3 Query: 183 SDSVRKIMSACDVEALKKCLEENKGDQTKCRSQIEAF 293 S SV+KI SACDVEALKKCLEENKGD KC++QIEAF Sbjct: 8 SSSVKKINSACDVEALKKCLEENKGDYAKCQTQIEAF 44 >ref|XP_002513686.1| conserved hypothetical protein [Ricinus communis] gi|223547594|gb|EEF49089.1| conserved hypothetical protein [Ricinus communis] Length = 62 Score = 63.5 bits (153), Expect = 4e-08 Identities = 28/37 (75%), Positives = 32/37 (86%) Frame = +3 Query: 183 SDSVRKIMSACDVEALKKCLEENKGDQTKCRSQIEAF 293 S S +K++S CDVEALKKCLEENKGD KC+SQIEAF Sbjct: 7 SSSAKKVLSPCDVEALKKCLEENKGDYVKCQSQIEAF 43 >ref|XP_002298135.2| hypothetical protein POPTR_0001s17870g, partial [Populus trichocarpa] gi|550347567|gb|EEE82940.2| hypothetical protein POPTR_0001s17870g, partial [Populus trichocarpa] Length = 134 Score = 62.8 bits (151), Expect = 7e-08 Identities = 28/37 (75%), Positives = 32/37 (86%) Frame = +3 Query: 183 SDSVRKIMSACDVEALKKCLEENKGDQTKCRSQIEAF 293 S +K++SACDVEALKKCLEENKGD KC+SQIEAF Sbjct: 75 SKGPKKVLSACDVEALKKCLEENKGDYVKCQSQIEAF 111 >ref|XP_003592261.1| hypothetical protein MTR_1g100890 [Medicago truncatula] gi|355481309|gb|AES62512.1| hypothetical protein MTR_1g100890 [Medicago truncatula] Length = 68 Score = 61.6 bits (148), Expect = 2e-07 Identities = 28/37 (75%), Positives = 33/37 (89%) Frame = +3 Query: 183 SDSVRKIMSACDVEALKKCLEENKGDQTKCRSQIEAF 293 S +V+KI SACDV+ALKKCLEENKG+ KC+SQIEAF Sbjct: 8 SSNVKKINSACDVDALKKCLEENKGNYVKCQSQIEAF 44 >ref|XP_003576875.1| PREDICTED: uncharacterized protein LOC100826273 [Brachypodium distachyon] Length = 75 Score = 55.8 bits (133), Expect = 9e-06 Identities = 24/32 (75%), Positives = 29/32 (90%) Frame = +3 Query: 198 KIMSACDVEALKKCLEENKGDQTKCRSQIEAF 293 K SACDVEAL+KCLEENKGD+ KC++QI+AF Sbjct: 22 KKASACDVEALRKCLEENKGDRAKCKAQIDAF 53