BLASTX nr result
ID: Mentha28_contig00031082
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Mentha28_contig00031082 (514 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_006573486.1| PREDICTED: probable polyamine transporter At... 59 7e-07 ref|XP_003517084.1| PREDICTED: probable polyamine transporter At... 59 7e-07 ref|XP_004513415.1| PREDICTED: probable polyamine transporter At... 56 6e-06 emb|CBI37465.3| unnamed protein product [Vitis vinifera] 56 6e-06 ref|XP_002263817.1| PREDICTED: uncharacterized transporter lpg16... 56 6e-06 >ref|XP_006573486.1| PREDICTED: probable polyamine transporter At1g31830-like isoform X2 [Glycine max] Length = 490 Score = 58.9 bits (141), Expect = 7e-07 Identities = 26/34 (76%), Positives = 31/34 (91%) Frame = -2 Query: 471 SLKVMVISLIAFLVGLVLQPCLKLIEKKEWLRFS 370 SLKVMVISLIA +GLV+QPCLKL+EKK W++FS Sbjct: 438 SLKVMVISLIAMAIGLVMQPCLKLVEKKRWMKFS 471 >ref|XP_003517084.1| PREDICTED: probable polyamine transporter At1g31830-like isoform X1 [Glycine max] Length = 486 Score = 58.9 bits (141), Expect = 7e-07 Identities = 26/34 (76%), Positives = 31/34 (91%) Frame = -2 Query: 471 SLKVMVISLIAFLVGLVLQPCLKLIEKKEWLRFS 370 SLKVMVISLIA +GLV+QPCLKL+EKK W++FS Sbjct: 434 SLKVMVISLIAMAIGLVMQPCLKLVEKKRWMKFS 467 >ref|XP_004513415.1| PREDICTED: probable polyamine transporter At1g31830-like [Cicer arietinum] Length = 462 Score = 55.8 bits (133), Expect = 6e-06 Identities = 23/34 (67%), Positives = 31/34 (91%) Frame = -2 Query: 471 SLKVMVISLIAFLVGLVLQPCLKLIEKKEWLRFS 370 S+KVMVIS IA ++GLV+QPCLK +EKK+W++FS Sbjct: 410 SIKVMVISFIALVIGLVMQPCLKFVEKKKWVKFS 443 >emb|CBI37465.3| unnamed protein product [Vitis vinifera] Length = 375 Score = 55.8 bits (133), Expect = 6e-06 Identities = 25/34 (73%), Positives = 30/34 (88%) Frame = -2 Query: 471 SLKVMVISLIAFLVGLVLQPCLKLIEKKEWLRFS 370 SLKV V+SLIA ++GLVLQPCLK IE+K WL+FS Sbjct: 315 SLKVAVVSLIAVIIGLVLQPCLKCIERKRWLKFS 348 >ref|XP_002263817.1| PREDICTED: uncharacterized transporter lpg1691-like [Vitis vinifera] Length = 475 Score = 55.8 bits (133), Expect = 6e-06 Identities = 25/34 (73%), Positives = 30/34 (88%) Frame = -2 Query: 471 SLKVMVISLIAFLVGLVLQPCLKLIEKKEWLRFS 370 SLKV V+SLIA ++GLVLQPCLK IE+K WL+FS Sbjct: 421 SLKVAVVSLIAVIIGLVLQPCLKCIERKRWLKFS 454