BLASTX nr result
ID: Mentha28_contig00031069
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Mentha28_contig00031069 (318 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_006451105.1| hypothetical protein CICLE_v10007378mg [Citr... 84 2e-14 ref|XP_004243751.1| PREDICTED: probable pre-mRNA-splicing factor... 84 3e-14 gb|EYU27319.1| hypothetical protein MIMGU_mgv1a000393mg [Mimulus... 83 3e-14 gb|EXB44282.1| putative pre-mRNA-splicing factor ATP-dependent R... 83 3e-14 ref|XP_006466902.1| PREDICTED: probable pre-mRNA-splicing factor... 83 3e-14 ref|XP_007160687.1| hypothetical protein PHAVU_001G008600g [Phas... 83 3e-14 ref|XP_006425547.1| hypothetical protein CICLE_v10024740mg [Citr... 83 3e-14 ref|XP_006395547.1| hypothetical protein EUTSA_v100035630mg, par... 83 3e-14 ref|XP_006374312.1| ATP-dependent RNA helicase family protein [P... 83 3e-14 ref|XP_006850962.1| hypothetical protein AMTR_s00025p00202360 [A... 83 3e-14 gb|EPS73374.1| hypothetical protein M569_01376, partial [Genlise... 83 3e-14 ref|XP_007017747.1| Pre-mRNA-splicing factor ATP-dependent RNA h... 83 3e-14 ref|XP_004499233.1| PREDICTED: probable pre-mRNA-splicing factor... 83 3e-14 ref|XP_004498154.1| PREDICTED: probable pre-mRNA-splicing factor... 83 3e-14 ref|XP_006290254.1| hypothetical protein CARUB_v10016599mg [Caps... 83 3e-14 ref|XP_004306870.1| PREDICTED: probable pre-mRNA-splicing factor... 83 3e-14 ref|XP_007213721.1| hypothetical protein PRUPE_ppa000417mg [Prun... 83 3e-14 ref|XP_007212060.1| hypothetical protein PRUPE_ppa011497mg [Prun... 83 3e-14 ref|XP_004156439.1| PREDICTED: probable pre-mRNA-splicing factor... 83 3e-14 ref|XP_004139208.1| PREDICTED: uncharacterized protein LOC101216... 83 3e-14 >ref|XP_006451105.1| hypothetical protein CICLE_v10007378mg [Citrus clementina] gi|568843643|ref|XP_006475709.1| PREDICTED: probable pre-mRNA-splicing factor ATP-dependent RNA helicase-like [Citrus sinensis] gi|557554331|gb|ESR64345.1| hypothetical protein CICLE_v10007378mg [Citrus clementina] Length = 942 Score = 84.3 bits (207), Expect = 2e-14 Identities = 38/43 (88%), Positives = 40/43 (93%) Frame = -1 Query: 318 VAPTFFKVGDPTKISTRKRQQRIEPLYDRYHEPNSWRLSKRRA 190 +AP FFKV DPTKIS RKRQ+RIEPLYDRYHEPNSWRLSKRRA Sbjct: 900 LAPKFFKVADPTKISKRKRQERIEPLYDRYHEPNSWRLSKRRA 942 >ref|XP_004243751.1| PREDICTED: probable pre-mRNA-splicing factor ATP-dependent RNA helicase-like [Solanum lycopersicum] Length = 1190 Score = 83.6 bits (205), Expect = 3e-14 Identities = 37/43 (86%), Positives = 40/43 (93%) Frame = -1 Query: 318 VAPTFFKVGDPTKISTRKRQQRIEPLYDRYHEPNSWRLSKRRA 190 +AP FFKV DPTK+S RKRQ+RIEPLYDRYHEPNSWRLSKRRA Sbjct: 1148 LAPRFFKVSDPTKLSKRKRQERIEPLYDRYHEPNSWRLSKRRA 1190 >gb|EYU27319.1| hypothetical protein MIMGU_mgv1a000393mg [Mimulus guttatus] Length = 1190 Score = 83.2 bits (204), Expect = 3e-14 Identities = 37/43 (86%), Positives = 40/43 (93%) Frame = -1 Query: 318 VAPTFFKVGDPTKISTRKRQQRIEPLYDRYHEPNSWRLSKRRA 190 +AP FFKV DPTK+S RKRQ+RIEPLYDRYHEPNSWRLSKRRA Sbjct: 1148 LAPRFFKVSDPTKMSKRKRQERIEPLYDRYHEPNSWRLSKRRA 1190 >gb|EXB44282.1| putative pre-mRNA-splicing factor ATP-dependent RNA helicase [Morus notabilis] Length = 1205 Score = 83.2 bits (204), Expect = 3e-14 Identities = 37/43 (86%), Positives = 40/43 (93%) Frame = -1 Query: 318 VAPTFFKVGDPTKISTRKRQQRIEPLYDRYHEPNSWRLSKRRA 190 +AP FFKV DPTK+S RKRQ+RIEPLYDRYHEPNSWRLSKRRA Sbjct: 1163 LAPRFFKVADPTKMSKRKRQERIEPLYDRYHEPNSWRLSKRRA 1205 >ref|XP_006466902.1| PREDICTED: probable pre-mRNA-splicing factor ATP-dependent RNA helicase-like isoform X1 [Citrus sinensis] gi|568825052|ref|XP_006466903.1| PREDICTED: probable pre-mRNA-splicing factor ATP-dependent RNA helicase-like isoform X2 [Citrus sinensis] Length = 1176 Score = 83.2 bits (204), Expect = 3e-14 Identities = 37/43 (86%), Positives = 40/43 (93%) Frame = -1 Query: 318 VAPTFFKVGDPTKISTRKRQQRIEPLYDRYHEPNSWRLSKRRA 190 +AP FFKV DPTK+S RKRQ+RIEPLYDRYHEPNSWRLSKRRA Sbjct: 1134 LAPRFFKVADPTKMSKRKRQERIEPLYDRYHEPNSWRLSKRRA 1176 >ref|XP_007160687.1| hypothetical protein PHAVU_001G008600g [Phaseolus vulgaris] gi|561034151|gb|ESW32681.1| hypothetical protein PHAVU_001G008600g [Phaseolus vulgaris] Length = 1201 Score = 83.2 bits (204), Expect = 3e-14 Identities = 37/43 (86%), Positives = 40/43 (93%) Frame = -1 Query: 318 VAPTFFKVGDPTKISTRKRQQRIEPLYDRYHEPNSWRLSKRRA 190 +AP FFKV DPTK+S RKRQ+RIEPLYDRYHEPNSWRLSKRRA Sbjct: 1159 LAPRFFKVADPTKMSKRKRQERIEPLYDRYHEPNSWRLSKRRA 1201 >ref|XP_006425547.1| hypothetical protein CICLE_v10024740mg [Citrus clementina] gi|557527537|gb|ESR38787.1| hypothetical protein CICLE_v10024740mg [Citrus clementina] Length = 1176 Score = 83.2 bits (204), Expect = 3e-14 Identities = 37/43 (86%), Positives = 40/43 (93%) Frame = -1 Query: 318 VAPTFFKVGDPTKISTRKRQQRIEPLYDRYHEPNSWRLSKRRA 190 +AP FFKV DPTK+S RKRQ+RIEPLYDRYHEPNSWRLSKRRA Sbjct: 1134 LAPRFFKVADPTKMSKRKRQERIEPLYDRYHEPNSWRLSKRRA 1176 >ref|XP_006395547.1| hypothetical protein EUTSA_v100035630mg, partial [Eutrema salsugineum] gi|557092186|gb|ESQ32833.1| hypothetical protein EUTSA_v100035630mg, partial [Eutrema salsugineum] Length = 236 Score = 83.2 bits (204), Expect = 3e-14 Identities = 37/43 (86%), Positives = 40/43 (93%) Frame = -1 Query: 318 VAPTFFKVGDPTKISTRKRQQRIEPLYDRYHEPNSWRLSKRRA 190 +AP FFKV DPTK+S RKRQ+RIEPLYDRYHEPNSWRLSKRRA Sbjct: 194 LAPRFFKVADPTKMSKRKRQERIEPLYDRYHEPNSWRLSKRRA 236 >ref|XP_006374312.1| ATP-dependent RNA helicase family protein [Populus trichocarpa] gi|550322071|gb|ERP52109.1| ATP-dependent RNA helicase family protein [Populus trichocarpa] Length = 1177 Score = 83.2 bits (204), Expect = 3e-14 Identities = 37/43 (86%), Positives = 40/43 (93%) Frame = -1 Query: 318 VAPTFFKVGDPTKISTRKRQQRIEPLYDRYHEPNSWRLSKRRA 190 +AP FFKV DPTK+S RKRQ+RIEPLYDRYHEPNSWRLSKRRA Sbjct: 1135 LAPRFFKVSDPTKMSKRKRQERIEPLYDRYHEPNSWRLSKRRA 1177 >ref|XP_006850962.1| hypothetical protein AMTR_s00025p00202360 [Amborella trichopoda] gi|548854633|gb|ERN12543.1| hypothetical protein AMTR_s00025p00202360 [Amborella trichopoda] Length = 1202 Score = 83.2 bits (204), Expect = 3e-14 Identities = 37/43 (86%), Positives = 40/43 (93%) Frame = -1 Query: 318 VAPTFFKVGDPTKISTRKRQQRIEPLYDRYHEPNSWRLSKRRA 190 +AP FFKV DPTK+S RKRQ+RIEPLYDRYHEPNSWRLSKRRA Sbjct: 1160 LAPRFFKVADPTKMSKRKRQERIEPLYDRYHEPNSWRLSKRRA 1202 >gb|EPS73374.1| hypothetical protein M569_01376, partial [Genlisea aurea] Length = 1164 Score = 83.2 bits (204), Expect = 3e-14 Identities = 37/43 (86%), Positives = 40/43 (93%) Frame = -1 Query: 318 VAPTFFKVGDPTKISTRKRQQRIEPLYDRYHEPNSWRLSKRRA 190 +AP FFKV DPTK+S RKRQ+RIEPLYDRYHEPNSWRLSKRRA Sbjct: 1122 LAPRFFKVADPTKMSKRKRQERIEPLYDRYHEPNSWRLSKRRA 1164 >ref|XP_007017747.1| Pre-mRNA-splicing factor ATP-dependent RNA helicase isoform 1 [Theobroma cacao] gi|590594063|ref|XP_007017748.1| Pre-mRNA-splicing factor ATP-dependent RNA helicase isoform 1 [Theobroma cacao] gi|508723075|gb|EOY14972.1| Pre-mRNA-splicing factor ATP-dependent RNA helicase isoform 1 [Theobroma cacao] gi|508723076|gb|EOY14973.1| Pre-mRNA-splicing factor ATP-dependent RNA helicase isoform 1 [Theobroma cacao] Length = 1185 Score = 83.2 bits (204), Expect = 3e-14 Identities = 37/43 (86%), Positives = 40/43 (93%) Frame = -1 Query: 318 VAPTFFKVGDPTKISTRKRQQRIEPLYDRYHEPNSWRLSKRRA 190 +AP FFKV DPTK+S RKRQ+RIEPLYDRYHEPNSWRLSKRRA Sbjct: 1143 LAPRFFKVADPTKMSKRKRQERIEPLYDRYHEPNSWRLSKRRA 1185 >ref|XP_004499233.1| PREDICTED: probable pre-mRNA-splicing factor ATP-dependent RNA helicase-like [Cicer arietinum] Length = 1203 Score = 83.2 bits (204), Expect = 3e-14 Identities = 37/43 (86%), Positives = 40/43 (93%) Frame = -1 Query: 318 VAPTFFKVGDPTKISTRKRQQRIEPLYDRYHEPNSWRLSKRRA 190 +AP FFKV DPTK+S RKRQ+RIEPLYDRYHEPNSWRLSKRRA Sbjct: 1161 LAPRFFKVADPTKMSKRKRQERIEPLYDRYHEPNSWRLSKRRA 1203 >ref|XP_004498154.1| PREDICTED: probable pre-mRNA-splicing factor ATP-dependent RNA helicase-like isoform X1 [Cicer arietinum] gi|502123536|ref|XP_004498155.1| PREDICTED: probable pre-mRNA-splicing factor ATP-dependent RNA helicase-like isoform X2 [Cicer arietinum] gi|502123538|ref|XP_004498156.1| PREDICTED: probable pre-mRNA-splicing factor ATP-dependent RNA helicase-like isoform X3 [Cicer arietinum] gi|502123540|ref|XP_004498157.1| PREDICTED: probable pre-mRNA-splicing factor ATP-dependent RNA helicase-like isoform X4 [Cicer arietinum] gi|502123542|ref|XP_004498158.1| PREDICTED: probable pre-mRNA-splicing factor ATP-dependent RNA helicase-like isoform X5 [Cicer arietinum] gi|502123544|ref|XP_004498159.1| PREDICTED: probable pre-mRNA-splicing factor ATP-dependent RNA helicase-like isoform X6 [Cicer arietinum] gi|502123546|ref|XP_004498160.1| PREDICTED: probable pre-mRNA-splicing factor ATP-dependent RNA helicase-like isoform X7 [Cicer arietinum] gi|502123548|ref|XP_004498161.1| PREDICTED: probable pre-mRNA-splicing factor ATP-dependent RNA helicase-like isoform X8 [Cicer arietinum] Length = 1178 Score = 83.2 bits (204), Expect = 3e-14 Identities = 37/43 (86%), Positives = 40/43 (93%) Frame = -1 Query: 318 VAPTFFKVGDPTKISTRKRQQRIEPLYDRYHEPNSWRLSKRRA 190 +AP FFKV DPTK+S RKRQ+RIEPLYDRYHEPNSWRLSKRRA Sbjct: 1136 LAPRFFKVSDPTKMSKRKRQERIEPLYDRYHEPNSWRLSKRRA 1178 >ref|XP_006290254.1| hypothetical protein CARUB_v10016599mg [Capsella rubella] gi|482558961|gb|EOA23152.1| hypothetical protein CARUB_v10016599mg [Capsella rubella] Length = 1174 Score = 83.2 bits (204), Expect = 3e-14 Identities = 37/43 (86%), Positives = 40/43 (93%) Frame = -1 Query: 318 VAPTFFKVGDPTKISTRKRQQRIEPLYDRYHEPNSWRLSKRRA 190 +AP FFKV DPTK+S RKRQ+RIEPLYDRYHEPNSWRLSKRRA Sbjct: 1132 LAPRFFKVSDPTKMSKRKRQERIEPLYDRYHEPNSWRLSKRRA 1174 >ref|XP_004306870.1| PREDICTED: probable pre-mRNA-splicing factor ATP-dependent RNA helicase-like [Fragaria vesca subsp. vesca] Length = 1203 Score = 83.2 bits (204), Expect = 3e-14 Identities = 37/43 (86%), Positives = 40/43 (93%) Frame = -1 Query: 318 VAPTFFKVGDPTKISTRKRQQRIEPLYDRYHEPNSWRLSKRRA 190 +AP FFKV DPTK+S RKRQ+RIEPLYDRYHEPNSWRLSKRRA Sbjct: 1161 LAPRFFKVADPTKMSKRKRQERIEPLYDRYHEPNSWRLSKRRA 1203 >ref|XP_007213721.1| hypothetical protein PRUPE_ppa000417mg [Prunus persica] gi|462409586|gb|EMJ14920.1| hypothetical protein PRUPE_ppa000417mg [Prunus persica] Length = 1198 Score = 83.2 bits (204), Expect = 3e-14 Identities = 37/43 (86%), Positives = 40/43 (93%) Frame = -1 Query: 318 VAPTFFKVGDPTKISTRKRQQRIEPLYDRYHEPNSWRLSKRRA 190 +AP FFKV DPTK+S RKRQ+RIEPLYDRYHEPNSWRLSKRRA Sbjct: 1156 LAPRFFKVADPTKMSKRKRQERIEPLYDRYHEPNSWRLSKRRA 1198 >ref|XP_007212060.1| hypothetical protein PRUPE_ppa011497mg [Prunus persica] gi|462407925|gb|EMJ13259.1| hypothetical protein PRUPE_ppa011497mg [Prunus persica] Length = 208 Score = 83.2 bits (204), Expect = 3e-14 Identities = 37/43 (86%), Positives = 40/43 (93%) Frame = -1 Query: 318 VAPTFFKVGDPTKISTRKRQQRIEPLYDRYHEPNSWRLSKRRA 190 +AP FFKV DPTK+S RKRQ+RIEPLYDRYHEPNSWRLSKRRA Sbjct: 166 LAPRFFKVADPTKMSKRKRQERIEPLYDRYHEPNSWRLSKRRA 208 >ref|XP_004156439.1| PREDICTED: probable pre-mRNA-splicing factor ATP-dependent RNA helicase-like [Cucumis sativus] Length = 1181 Score = 83.2 bits (204), Expect = 3e-14 Identities = 37/43 (86%), Positives = 40/43 (93%) Frame = -1 Query: 318 VAPTFFKVGDPTKISTRKRQQRIEPLYDRYHEPNSWRLSKRRA 190 +AP FFKV DPTK+S RKRQ+RIEPLYDRYHEPNSWRLSKRRA Sbjct: 1139 LAPRFFKVSDPTKMSKRKRQERIEPLYDRYHEPNSWRLSKRRA 1181 >ref|XP_004139208.1| PREDICTED: uncharacterized protein LOC101216792 [Cucumis sativus] Length = 1218 Score = 83.2 bits (204), Expect = 3e-14 Identities = 37/43 (86%), Positives = 40/43 (93%) Frame = -1 Query: 318 VAPTFFKVGDPTKISTRKRQQRIEPLYDRYHEPNSWRLSKRRA 190 +AP FFKV DPTK+S RKRQ+RIEPLYDRYHEPNSWRLSKRRA Sbjct: 1176 LAPRFFKVSDPTKMSKRKRQERIEPLYDRYHEPNSWRLSKRRA 1218