BLASTX nr result
ID: Mentha28_contig00030847
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Mentha28_contig00030847 (424 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EYU18475.1| hypothetical protein MIMGU_mgv1a020842mg [Mimulus... 90 3e-16 ref|XP_002268888.1| PREDICTED: outer envelope protein 64, mitoch... 90 4e-16 ref|XP_002298203.2| chloroplast outer membrane translocon subuni... 88 1e-15 ref|XP_007042951.1| Translocon at the outer membrane of chloropl... 88 1e-15 gb|EPS65438.1| hypothetical protein M569_09339, partial [Genlise... 86 4e-15 ref|XP_007200962.1| hypothetical protein PRUPE_ppa003071mg [Prun... 86 4e-15 ref|XP_006341842.1| PREDICTED: outer envelope protein 64, mitoch... 85 9e-15 ref|XP_004248799.1| PREDICTED: outer envelope protein 64, mitoch... 85 9e-15 ref|XP_003524732.1| PREDICTED: outer envelope protein 64, mitoch... 85 9e-15 ref|XP_004136877.1| PREDICTED: outer envelope protein 64, mitoch... 85 1e-14 ref|XP_002525865.1| amidase, putative [Ricinus communis] gi|2235... 84 2e-14 ref|XP_004504805.1| PREDICTED: LOW QUALITY PROTEIN: outer envelo... 84 2e-14 ref|XP_003531546.1| PREDICTED: outer envelope protein 64, mitoch... 84 3e-14 ref|XP_006597351.1| PREDICTED: outer envelope protein 64, mitoch... 83 3e-14 ref|XP_006597350.1| PREDICTED: outer envelope protein 64, mitoch... 83 3e-14 ref|XP_007159113.1| hypothetical protein PHAVU_002G209800g [Phas... 83 3e-14 ref|XP_006286476.1| hypothetical protein CARUB_v10000509mg [Caps... 83 4e-14 ref|XP_006493887.1| PREDICTED: outer envelope protein 64, mitoch... 82 6e-14 ref|XP_007148409.1| hypothetical protein PHAVU_006G206200g [Phas... 82 1e-13 ref|NP_196504.2| translocon at the outer membrane of chloroplast... 82 1e-13 >gb|EYU18475.1| hypothetical protein MIMGU_mgv1a020842mg [Mimulus guttatus] Length = 602 Score = 90.1 bits (222), Expect = 3e-16 Identities = 44/49 (89%), Positives = 47/49 (95%) Frame = +1 Query: 1 KKNVKAYLRRGTAKESLLFYKEAHQDFKHALVLEPQNKVASLAEKRLRK 147 KKNVKAYLRRGTA+ES+LFYKEA QDFKHALVLEPQN+VA LAEKRLRK Sbjct: 551 KKNVKAYLRRGTARESMLFYKEALQDFKHALVLEPQNRVAGLAEKRLRK 599 >ref|XP_002268888.1| PREDICTED: outer envelope protein 64, mitochondrial [Vitis vinifera] gi|296086830|emb|CBI32979.3| unnamed protein product [Vitis vinifera] Length = 607 Score = 89.7 bits (221), Expect = 4e-16 Identities = 45/49 (91%), Positives = 47/49 (95%) Frame = +1 Query: 1 KKNVKAYLRRGTAKESLLFYKEAHQDFKHALVLEPQNKVASLAEKRLRK 147 KKNVKAYLRRGTA+ESLL YKEA QDFKHALVLEPQNKVA+LAEKRLRK Sbjct: 556 KKNVKAYLRRGTARESLLCYKEAAQDFKHALVLEPQNKVANLAEKRLRK 604 >ref|XP_002298203.2| chloroplast outer membrane translocon subunit family protein [Populus trichocarpa] gi|550347801|gb|EEE83008.2| chloroplast outer membrane translocon subunit family protein [Populus trichocarpa] Length = 599 Score = 88.2 bits (217), Expect = 1e-15 Identities = 44/49 (89%), Positives = 46/49 (93%) Frame = +1 Query: 1 KKNVKAYLRRGTAKESLLFYKEAHQDFKHALVLEPQNKVASLAEKRLRK 147 KKNVKAYLRRGTA+ESLLFYK+A QDFKHALVLEPQNKVA AEKRLRK Sbjct: 548 KKNVKAYLRRGTARESLLFYKDAAQDFKHALVLEPQNKVARHAEKRLRK 596 >ref|XP_007042951.1| Translocon at the outer membrane of chloroplasts 64-V isoform 1 [Theobroma cacao] gi|508706886|gb|EOX98782.1| Translocon at the outer membrane of chloroplasts 64-V isoform 1 [Theobroma cacao] Length = 606 Score = 88.2 bits (217), Expect = 1e-15 Identities = 44/49 (89%), Positives = 47/49 (95%) Frame = +1 Query: 1 KKNVKAYLRRGTAKESLLFYKEAHQDFKHALVLEPQNKVASLAEKRLRK 147 KKNVKAYLRRGTA+ESLL YKEA +DFKHALVLEPQNKVA+LAEKRLRK Sbjct: 555 KKNVKAYLRRGTARESLLCYKEALEDFKHALVLEPQNKVANLAEKRLRK 603 >gb|EPS65438.1| hypothetical protein M569_09339, partial [Genlisea aurea] Length = 592 Score = 86.3 bits (212), Expect = 4e-15 Identities = 43/49 (87%), Positives = 45/49 (91%) Frame = +1 Query: 1 KKNVKAYLRRGTAKESLLFYKEAHQDFKHALVLEPQNKVASLAEKRLRK 147 KKNVKAYLRRGTAKESLLFYKEA QDFKHALVLEP NK A+ AEKRLR+ Sbjct: 541 KKNVKAYLRRGTAKESLLFYKEALQDFKHALVLEPHNKAAAEAEKRLRR 589 >ref|XP_007200962.1| hypothetical protein PRUPE_ppa003071mg [Prunus persica] gi|462396362|gb|EMJ02161.1| hypothetical protein PRUPE_ppa003071mg [Prunus persica] Length = 607 Score = 86.3 bits (212), Expect = 4e-15 Identities = 42/49 (85%), Positives = 47/49 (95%) Frame = +1 Query: 1 KKNVKAYLRRGTAKESLLFYKEAHQDFKHALVLEPQNKVASLAEKRLRK 147 KKNVKAY+RRGTA+ESLL YK+A QDFKHALVLEPQNKVA+LAEKRLR+ Sbjct: 556 KKNVKAYMRRGTARESLLCYKDAAQDFKHALVLEPQNKVANLAEKRLRE 604 >ref|XP_006341842.1| PREDICTED: outer envelope protein 64, mitochondrial-like [Solanum tuberosum] Length = 598 Score = 85.1 bits (209), Expect = 9e-15 Identities = 41/49 (83%), Positives = 46/49 (93%) Frame = +1 Query: 1 KKNVKAYLRRGTAKESLLFYKEAHQDFKHALVLEPQNKVASLAEKRLRK 147 KKNVKAY+RRGTA+ESLLFYKEA QD +HALVLEPQNK AS++EKRLRK Sbjct: 547 KKNVKAYMRRGTARESLLFYKEALQDIRHALVLEPQNKFASVSEKRLRK 595 >ref|XP_004248799.1| PREDICTED: outer envelope protein 64, mitochondrial-like [Solanum lycopersicum] Length = 598 Score = 85.1 bits (209), Expect = 9e-15 Identities = 41/49 (83%), Positives = 46/49 (93%) Frame = +1 Query: 1 KKNVKAYLRRGTAKESLLFYKEAHQDFKHALVLEPQNKVASLAEKRLRK 147 KKNVKAY+RRGTA+ESLLFYKEA QD +HALVLEPQNK AS++EKRLRK Sbjct: 547 KKNVKAYMRRGTARESLLFYKEALQDIRHALVLEPQNKYASVSEKRLRK 595 >ref|XP_003524732.1| PREDICTED: outer envelope protein 64, mitochondrial-like [Glycine max] Length = 603 Score = 85.1 bits (209), Expect = 9e-15 Identities = 43/49 (87%), Positives = 46/49 (93%) Frame = +1 Query: 1 KKNVKAYLRRGTAKESLLFYKEAHQDFKHALVLEPQNKVASLAEKRLRK 147 KKNVKAYLRRGTA+ESLL Y+EA +DFKHALVLEPQNK ASLAEKRLRK Sbjct: 552 KKNVKAYLRRGTARESLLCYEEALEDFKHALVLEPQNKDASLAEKRLRK 600 >ref|XP_004136877.1| PREDICTED: outer envelope protein 64, mitochondrial-like [Cucumis sativus] Length = 606 Score = 84.7 bits (208), Expect = 1e-14 Identities = 42/49 (85%), Positives = 46/49 (93%) Frame = +1 Query: 1 KKNVKAYLRRGTAKESLLFYKEAHQDFKHALVLEPQNKVASLAEKRLRK 147 KK VKAYLRRGTA+ESLL YKEA +DFKHALVLEPQNKVA+LAEKRL+K Sbjct: 555 KKTVKAYLRRGTARESLLLYKEAIKDFKHALVLEPQNKVANLAEKRLQK 603 >ref|XP_002525865.1| amidase, putative [Ricinus communis] gi|223534870|gb|EEF36559.1| amidase, putative [Ricinus communis] Length = 607 Score = 84.3 bits (207), Expect = 2e-14 Identities = 42/49 (85%), Positives = 44/49 (89%) Frame = +1 Query: 1 KKNVKAYLRRGTAKESLLFYKEAHQDFKHALVLEPQNKVASLAEKRLRK 147 KKNVKAYLRRGTAKESLL+YKEA QDFKHALVLEP NK A AE+RLRK Sbjct: 556 KKNVKAYLRRGTAKESLLYYKEAAQDFKHALVLEPHNKAAREAEERLRK 604 >ref|XP_004504805.1| PREDICTED: LOW QUALITY PROTEIN: outer envelope protein 64, mitochondrial-like [Cicer arietinum] Length = 606 Score = 84.0 bits (206), Expect = 2e-14 Identities = 42/49 (85%), Positives = 46/49 (93%) Frame = +1 Query: 1 KKNVKAYLRRGTAKESLLFYKEAHQDFKHALVLEPQNKVASLAEKRLRK 147 KKNVKAYLRRGTA+ESLL YKEA +DFKHALVLEPQNK AS+AEKR+RK Sbjct: 555 KKNVKAYLRRGTARESLLRYKEALEDFKHALVLEPQNKDASVAEKRVRK 603 >ref|XP_003531546.1| PREDICTED: outer envelope protein 64, mitochondrial-like isoform X1 [Glycine max] Length = 598 Score = 83.6 bits (205), Expect = 3e-14 Identities = 42/49 (85%), Positives = 45/49 (91%) Frame = +1 Query: 1 KKNVKAYLRRGTAKESLLFYKEAHQDFKHALVLEPQNKVASLAEKRLRK 147 KKNVKAYLRRGTA+E LL YKEA +DF+HALVLEPQNK ASLAEKRLRK Sbjct: 547 KKNVKAYLRRGTAREVLLCYKEALKDFQHALVLEPQNKTASLAEKRLRK 595 >ref|XP_006597351.1| PREDICTED: outer envelope protein 64, mitochondrial-like isoform X2 [Glycine max] Length = 506 Score = 83.2 bits (204), Expect = 3e-14 Identities = 42/49 (85%), Positives = 45/49 (91%) Frame = +1 Query: 1 KKNVKAYLRRGTAKESLLFYKEAHQDFKHALVLEPQNKVASLAEKRLRK 147 KKNVKAYLRRGTA+E LL YKEA +DF+HALVLEPQNK ASLAEKRLRK Sbjct: 455 KKNVKAYLRRGTARELLLRYKEALKDFQHALVLEPQNKTASLAEKRLRK 503 >ref|XP_006597350.1| PREDICTED: outer envelope protein 64, mitochondrial-like isoform X1 [Glycine max] Length = 598 Score = 83.2 bits (204), Expect = 3e-14 Identities = 42/49 (85%), Positives = 45/49 (91%) Frame = +1 Query: 1 KKNVKAYLRRGTAKESLLFYKEAHQDFKHALVLEPQNKVASLAEKRLRK 147 KKNVKAYLRRGTA+E LL YKEA +DF+HALVLEPQNK ASLAEKRLRK Sbjct: 547 KKNVKAYLRRGTARELLLRYKEALKDFQHALVLEPQNKTASLAEKRLRK 595 >ref|XP_007159113.1| hypothetical protein PHAVU_002G209800g [Phaseolus vulgaris] gi|561032528|gb|ESW31107.1| hypothetical protein PHAVU_002G209800g [Phaseolus vulgaris] Length = 602 Score = 83.2 bits (204), Expect = 3e-14 Identities = 42/49 (85%), Positives = 45/49 (91%) Frame = +1 Query: 1 KKNVKAYLRRGTAKESLLFYKEAHQDFKHALVLEPQNKVASLAEKRLRK 147 KKNVKAYLRRG A+ESLL Y+EA +DFKHALVLEPQNK ASLAEKRLRK Sbjct: 551 KKNVKAYLRRGAARESLLCYEEALEDFKHALVLEPQNKDASLAEKRLRK 599 >ref|XP_006286476.1| hypothetical protein CARUB_v10000509mg [Capsella rubella] gi|482555182|gb|EOA19374.1| hypothetical protein CARUB_v10000509mg [Capsella rubella] Length = 604 Score = 82.8 bits (203), Expect = 4e-14 Identities = 41/49 (83%), Positives = 44/49 (89%) Frame = +1 Query: 1 KKNVKAYLRRGTAKESLLFYKEAHQDFKHALVLEPQNKVASLAEKRLRK 147 KKNVKAYLRRGTA+ESL+ YKEA DF+HALVLEPQNK A LAEKRLRK Sbjct: 553 KKNVKAYLRRGTARESLVRYKEAAADFRHALVLEPQNKTAKLAEKRLRK 601 >ref|XP_006493887.1| PREDICTED: outer envelope protein 64, mitochondrial-like [Citrus sinensis] Length = 605 Score = 82.4 bits (202), Expect = 6e-14 Identities = 40/49 (81%), Positives = 44/49 (89%) Frame = +1 Query: 1 KKNVKAYLRRGTAKESLLFYKEAHQDFKHALVLEPQNKVASLAEKRLRK 147 KKNVKAYLRRGTA+E+L Y EA QDFKHA+VLEPQNK A+LAEKRLRK Sbjct: 554 KKNVKAYLRRGTAREALFCYNEALQDFKHAMVLEPQNKAANLAEKRLRK 602 >ref|XP_007148409.1| hypothetical protein PHAVU_006G206200g [Phaseolus vulgaris] gi|561021632|gb|ESW20403.1| hypothetical protein PHAVU_006G206200g [Phaseolus vulgaris] Length = 599 Score = 81.6 bits (200), Expect = 1e-13 Identities = 41/49 (83%), Positives = 45/49 (91%) Frame = +1 Query: 1 KKNVKAYLRRGTAKESLLFYKEAHQDFKHALVLEPQNKVASLAEKRLRK 147 KKNVKAYLRRGTA+E LL Y+EA +DF+HALVLEPQNK ASLAEKRLRK Sbjct: 548 KKNVKAYLRRGTARELLLRYEEALKDFQHALVLEPQNKTASLAEKRLRK 596 >ref|NP_196504.2| translocon at the outer membrane of chloroplasts 64-V [Arabidopsis thaliana] gi|357580466|sp|F4KCL7.1|OE64M_ARATH RecName: Full=Outer envelope protein 64, mitochondrial; AltName: Full=Mitochondrial outer membrane protein 64; Short=mtOM64; AltName: Full=Translocon at the outer membrane of chloroplasts 64-V; Short=AtTOC64-V gi|332004008|gb|AED91391.1| translocon at the outer membrane of chloroplasts 64-V [Arabidopsis thaliana] Length = 603 Score = 81.6 bits (200), Expect = 1e-13 Identities = 40/49 (81%), Positives = 44/49 (89%) Frame = +1 Query: 1 KKNVKAYLRRGTAKESLLFYKEAHQDFKHALVLEPQNKVASLAEKRLRK 147 KKNVKAYLRRGTA+ESL+ YKEA DF+HALVLEPQNK A +AEKRLRK Sbjct: 553 KKNVKAYLRRGTARESLVRYKEAAADFRHALVLEPQNKTAKVAEKRLRK 601