BLASTX nr result
ID: Mentha28_contig00030604
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Mentha28_contig00030604 (366 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|AAA84682.1| unknown protein (chloroplast) [Nicotiana tabacum]... 83 3e-14 gb|EYU35473.1| hypothetical protein MIMGU_mgv11b021317mg [Mimulu... 64 2e-08 gb|EYU41120.1| hypothetical protein MIMGU_mgv11b021666mg, partia... 60 3e-07 >gb|AAA84682.1| unknown protein (chloroplast) [Nicotiana tabacum] gi|224352|prf||1102209F ORF 6 Length = 79 Score = 83.2 bits (204), Expect = 3e-14 Identities = 46/79 (58%), Positives = 50/79 (63%), Gaps = 1/79 (1%) Frame = -1 Query: 345 MKVDYLSVHFKTSIIPSRTKHESFDSFGSHAQLFRVNSHSFFMNVMS-LXXXXXXXXXXX 169 MKVDY S+ F+ SIIPSRTKHESFDSFGSHAQL +VNSH FF + Sbjct: 1 MKVDYFSIPFQNSIIPSRTKHESFDSFGSHAQLLKVNSHIFFYECNEPIFSSLFIFQKDI 60 Query: 168 XXXXXXKYLEDSSDKIKNM 112 KY EDSSDKIKNM Sbjct: 61 ETNVIPKYSEDSSDKIKNM 79 >gb|EYU35473.1| hypothetical protein MIMGU_mgv11b021317mg [Mimulus guttatus] Length = 70 Score = 64.3 bits (155), Expect = 2e-08 Identities = 31/38 (81%), Positives = 31/38 (81%) Frame = -1 Query: 345 MKVDYLSVHFKTSIIPSRTKHESFDSFGSHAQLFRVNS 232 MKVDYL VHFK SIIPSRTKHES DSFGSH QL R S Sbjct: 1 MKVDYLFVHFKASIIPSRTKHESKDSFGSHVQLLRCKS 38 >gb|EYU41120.1| hypothetical protein MIMGU_mgv11b021666mg, partial [Mimulus guttatus] Length = 71 Score = 60.1 bits (144), Expect = 3e-07 Identities = 31/39 (79%), Positives = 32/39 (82%) Frame = -1 Query: 330 LSVHFKTSIIPSRTKHESFDSFGSHAQLFRVNSHSFFMN 214 LSVHFKTSIIPSRTKHESFD FGSHAQL R +FF N Sbjct: 13 LSVHFKTSIIPSRTKHESFDLFGSHAQLLR----TFFGN 47