BLASTX nr result
ID: Mentha28_contig00030560
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Mentha28_contig00030560 (527 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002320380.2| hypothetical protein POPTR_0014s13170g [Popu... 55 8e-06 gb|EPS58636.1| hypothetical protein M569_16177 [Genlisea aurea] 55 8e-06 >ref|XP_002320380.2| hypothetical protein POPTR_0014s13170g [Populus trichocarpa] gi|550324104|gb|EEE98695.2| hypothetical protein POPTR_0014s13170g [Populus trichocarpa] Length = 346 Score = 55.5 bits (132), Expect = 8e-06 Identities = 26/33 (78%), Positives = 28/33 (84%) Frame = -3 Query: 99 NIFEFLPQRVVPLNTWILISNFKLAYNMLRRPD 1 N+ E RVVPLNTWILISNFKLAYN+LRRPD Sbjct: 8 NLNESKVYRVVPLNTWILISNFKLAYNLLRRPD 40 >gb|EPS58636.1| hypothetical protein M569_16177 [Genlisea aurea] Length = 344 Score = 55.5 bits (132), Expect = 8e-06 Identities = 24/26 (92%), Positives = 26/26 (100%) Frame = -3 Query: 78 QRVVPLNTWILISNFKLAYNMLRRPD 1 +R+VPLNTWILISNFKLAYNMLRRPD Sbjct: 13 KRIVPLNTWILISNFKLAYNMLRRPD 38