BLASTX nr result
ID: Mentha28_contig00029939
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Mentha28_contig00029939 (415 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EYU46694.1| hypothetical protein MIMGU_mgv1a022667mg, partial... 55 1e-09 >gb|EYU46694.1| hypothetical protein MIMGU_mgv1a022667mg, partial [Mimulus guttatus] Length = 454 Score = 55.5 bits (132), Expect(2) = 1e-09 Identities = 27/54 (50%), Positives = 37/54 (68%) Frame = -1 Query: 382 ILHSLSIRCRTVVHVDQILAHQLCNNLKKNTMTIAAFITLCRSLDLLNSAAFSL 221 I+H L+ RC+T H+ QILAH + +NL+ +T FI C SL+LL+SAAF L Sbjct: 11 IIHLLNTRCKTRSHLRQILAHIILHNLRPDTTVAPHFIAACHSLNLLSSAAFPL 64 Score = 32.7 bits (73), Expect(2) = 1e-09 Identities = 12/23 (52%), Positives = 18/23 (78%) Frame = -3 Query: 224 FTNNHTRPHTYVCDTLLQAFTEN 156 + NN PHT+VC+TLL+AF+ + Sbjct: 65 YINNLATPHTFVCNTLLKAFSHS 87