BLASTX nr result
ID: Mentha28_contig00029336
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Mentha28_contig00029336 (341 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_006339545.1| PREDICTED: O-glucosyltransferase rumi-like [... 59 5e-07 >ref|XP_006339545.1| PREDICTED: O-glucosyltransferase rumi-like [Solanum tuberosum] Length = 519 Score = 59.3 bits (142), Expect = 5e-07 Identities = 33/63 (52%), Positives = 40/63 (63%), Gaps = 1/63 (1%) Frame = +2 Query: 155 MKGHEEKLMKIFWLRPAFQRHSPRTPSWKSFKKAVCSASALAL-LFFFVIAVSVLVFAGR 331 MK EKL FWLRPAFQ +SP+ WK FKK + +L LFFF++ VS+L FAG Sbjct: 1 MKEKNEKLKNEFWLRPAFQNNSPK---WKYFKKKTTTTLTKSLTLFFFLLVVSLLFFAGW 57 Query: 332 VDL 340 DL Sbjct: 58 FDL 60