BLASTX nr result
ID: Mentha28_contig00029331
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Mentha28_contig00029331 (352 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EPS66200.1| hypothetical protein M569_08577 [Genlisea aurea] 62 8e-08 gb|EYU29059.1| hypothetical protein MIMGU_mgv1a005079mg [Mimulus... 59 9e-07 gb|EYU29058.1| hypothetical protein MIMGU_mgv1a005079mg [Mimulus... 59 9e-07 >gb|EPS66200.1| hypothetical protein M569_08577 [Genlisea aurea] Length = 513 Score = 62.0 bits (149), Expect = 8e-08 Identities = 26/35 (74%), Positives = 31/35 (88%) Frame = -3 Query: 140 MGYENDPYRDENGEPLMDFDEDIPSDGDEPQQYLL 36 M YENDPYRDE+GEPLMDFDE+ PSD +E QQ++L Sbjct: 1 MAYENDPYRDEDGEPLMDFDEEYPSDREERQQHIL 35 >gb|EYU29059.1| hypothetical protein MIMGU_mgv1a005079mg [Mimulus guttatus] Length = 497 Score = 58.5 bits (140), Expect = 9e-07 Identities = 25/29 (86%), Positives = 27/29 (93%) Frame = -3 Query: 140 MGYENDPYRDENGEPLMDFDEDIPSDGDE 54 MGYENDPYRDE+GEPLMDFDEDI S+ DE Sbjct: 1 MGYENDPYRDEDGEPLMDFDEDIQSEHDE 29 >gb|EYU29058.1| hypothetical protein MIMGU_mgv1a005079mg [Mimulus guttatus] Length = 397 Score = 58.5 bits (140), Expect = 9e-07 Identities = 25/29 (86%), Positives = 27/29 (93%) Frame = -3 Query: 140 MGYENDPYRDENGEPLMDFDEDIPSDGDE 54 MGYENDPYRDE+GEPLMDFDEDI S+ DE Sbjct: 1 MGYENDPYRDEDGEPLMDFDEDIQSEHDE 29