BLASTX nr result
ID: Mentha28_contig00029330
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Mentha28_contig00029330 (459 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EYU23320.1| hypothetical protein MIMGU_mgv1a003200mg [Mimulus... 76 6e-12 >gb|EYU23320.1| hypothetical protein MIMGU_mgv1a003200mg [Mimulus guttatus] Length = 600 Score = 75.9 bits (185), Expect = 6e-12 Identities = 42/95 (44%), Positives = 51/95 (53%), Gaps = 5/95 (5%) Frame = +1 Query: 166 MKKLRNAEPAKLNPKSPRIRANXXXXXXXXXXXXXXXLSF-----PLFFSFWCAIVLFHA 330 MKK RNAEP KLN + +IRAN F PLFFSFWC + F++ Sbjct: 1 MKKSRNAEPKKLNDELGKIRANNHTNKLDFDDKIDRKSLFNLSAVPLFFSFWCFAIFFNS 60 Query: 331 KFGITRGNEGDLLAYGSKRNSEYLDEKSRNNTVNV 435 KFGIT GNEGDLL Y N+ ++ + N T V Sbjct: 61 KFGITDGNEGDLLPYNVSLNNSKIENRYENITSGV 95