BLASTX nr result
ID: Mentha28_contig00028158
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Mentha28_contig00028158 (683 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|YP_004237250.1| ribosomal protein S10 (mitochondrion) [Ricin... 59 1e-06 ref|XP_002310646.2| hypothetical protein POPTR_0007s07630g [Popu... 58 3e-06 ref|YP_002608378.1| ribosomal protein S10 [Vitis vinifera] gi|20... 58 3e-06 ref|YP_006460171.1| ribosomal protein subunit S10 (mitochondrion... 57 6e-06 ref|YP_008999584.1| ribosomal protein S10 (mitochondrion) [Vacci... 57 7e-06 ref|YP_008992302.1| ribosomal protein S10 (mitochondrion) [Salvi... 57 7e-06 ref|XP_007212276.1| hypothetical protein PRUPE_ppa013721mg [Prun... 56 1e-05 ref|XP_007202784.1| hypothetical protein PRUPE_ppa013702mg [Prun... 56 1e-05 >ref|YP_004237250.1| ribosomal protein S10 (mitochondrion) [Ricinus communis] gi|322394256|gb|ADW96013.1| ribosomal protein S10 (mitochondrion) [Ricinus communis] Length = 110 Score = 58.9 bits (141), Expect = 1e-06 Identities = 30/41 (73%), Positives = 33/41 (80%), Gaps = 1/41 (2%) Frame = +1 Query: 154 LHRSRVLYIVLRSPHIDKKSREQL-MRINNQYLVLKAETHE 273 L SRVLY VLRSPHIDKKSREQ M I N++LV+K ETHE Sbjct: 33 LPESRVLYTVLRSPHIDKKSREQFEMEIKNKFLVIKTETHE 73 >ref|XP_002310646.2| hypothetical protein POPTR_0007s07630g [Populus trichocarpa] gi|550334352|gb|EEE91096.2| hypothetical protein POPTR_0007s07630g [Populus trichocarpa] Length = 189 Score = 58.2 bits (139), Expect = 3e-06 Identities = 36/70 (51%), Positives = 43/70 (61%), Gaps = 1/70 (1%) Frame = +1 Query: 67 VSTSSFKSLHHG*FLNTSHQIRLVYNGSRLHRSRVLYIVLRSPHIDKKSREQL-MRINNQ 243 ++ SF+ L G NT I RL SRVLY VLRSPH+DKKSREQ MRI Q Sbjct: 85 IAIRSFEDLVPG---NTISGIPADARKIRLPESRVLYTVLRSPHVDKKSREQFEMRIKKQ 141 Query: 244 YLVLKAETHE 273 LV+K ++HE Sbjct: 142 ILVMKTQSHE 151 >ref|YP_002608378.1| ribosomal protein S10 [Vitis vinifera] gi|209954175|emb|CAQ77627.1| ribosomal protein S10 [Vitis vinifera] gi|239764725|gb|ACS15196.1| ribosomal protein S10 [Vitis vinifera] Length = 120 Score = 58.2 bits (139), Expect = 3e-06 Identities = 30/41 (73%), Positives = 32/41 (78%), Gaps = 1/41 (2%) Frame = +1 Query: 154 LHRSRVLYIVLRSPHIDKKSREQL-MRINNQYLVLKAETHE 273 L SRVLY VLRSPHIDKKSREQ M I Q+LV+K ETHE Sbjct: 33 LPESRVLYTVLRSPHIDKKSREQFEMEIKKQFLVIKTETHE 73 >ref|YP_006460171.1| ribosomal protein subunit S10 (mitochondrion) [Mimulus guttatus] gi|340007666|gb|AEK26530.1| ribosomal protein subunit S10 (mitochondrion) [Mimulus guttatus] Length = 110 Score = 57.0 bits (136), Expect = 6e-06 Identities = 28/41 (68%), Positives = 32/41 (78%), Gaps = 1/41 (2%) Frame = +1 Query: 154 LHRSRVLYIVLRSPHIDKKSREQL-MRINNQYLVLKAETHE 273 L SRVLY VLRSPHIDKKSREQ M+IN Q+ ++K E HE Sbjct: 33 LPESRVLYTVLRSPHIDKKSREQFEMKINKQFFIIKTERHE 73 >ref|YP_008999584.1| ribosomal protein S10 (mitochondrion) [Vaccinium macrocarpon] gi|549531659|gb|AGX28798.1| ribosomal protein S10 (mitochondrion) [Vaccinium macrocarpon] Length = 109 Score = 56.6 bits (135), Expect = 7e-06 Identities = 29/41 (70%), Positives = 32/41 (78%), Gaps = 1/41 (2%) Frame = +1 Query: 154 LHRSRVLYIVLRSPHIDKKSREQL-MRINNQYLVLKAETHE 273 L SRVLY VLRSPHIDKKSREQ M I ++LV+K ETHE Sbjct: 53 LPESRVLYTVLRSPHIDKKSREQFEMEIKKKFLVIKTETHE 93 >ref|YP_008992302.1| ribosomal protein S10 (mitochondrion) [Salvia miltiorrhiza] gi|534292376|gb|AGU16668.1| ribosomal protein S10 (mitochondrion) [Salvia miltiorrhiza] Length = 120 Score = 56.6 bits (135), Expect = 7e-06 Identities = 29/41 (70%), Positives = 32/41 (78%), Gaps = 1/41 (2%) Frame = +1 Query: 154 LHRSRVLYIVLRSPHIDKKSREQL-MRINNQYLVLKAETHE 273 L SRVLY VLRSPHIDKKSREQ M+I Q+LV+K E HE Sbjct: 33 LPESRVLYTVLRSPHIDKKSREQFEMKIKKQFLVIKTERHE 73 >ref|XP_007212276.1| hypothetical protein PRUPE_ppa013721mg [Prunus persica] gi|462408141|gb|EMJ13475.1| hypothetical protein PRUPE_ppa013721mg [Prunus persica] Length = 107 Score = 56.2 bits (134), Expect = 1e-05 Identities = 29/41 (70%), Positives = 31/41 (75%), Gaps = 1/41 (2%) Frame = +1 Query: 154 LHRSRVLYIVLRSPHIDKKSREQL-MRINNQYLVLKAETHE 273 L SRVLY VLRSPHIDKKSREQ M I QYLV+K + HE Sbjct: 30 LPESRVLYTVLRSPHIDKKSREQFKMEIKKQYLVIKTQPHE 70 >ref|XP_007202784.1| hypothetical protein PRUPE_ppa013702mg [Prunus persica] gi|462398315|gb|EMJ03983.1| hypothetical protein PRUPE_ppa013702mg [Prunus persica] Length = 107 Score = 56.2 bits (134), Expect = 1e-05 Identities = 29/41 (70%), Positives = 31/41 (75%), Gaps = 1/41 (2%) Frame = +1 Query: 154 LHRSRVLYIVLRSPHIDKKSREQL-MRINNQYLVLKAETHE 273 L SRVLY VLRSPHIDKKSREQ M I QYLV+K + HE Sbjct: 30 LPESRVLYTVLRSPHIDKKSREQFEMEIKKQYLVIKTQPHE 70