BLASTX nr result
ID: Mentha28_contig00027805
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Mentha28_contig00027805 (368 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EYU21848.1| hypothetical protein MIMGU_mgv1a023991mg [Mimulus... 56 5e-06 gb|EYU21838.1| hypothetical protein MIMGU_mgv1a001107mg [Mimulus... 56 5e-06 gb|EYU35738.1| hypothetical protein MIMGU_mgv1a020172mg, partial... 56 6e-06 >gb|EYU21848.1| hypothetical protein MIMGU_mgv1a023991mg [Mimulus guttatus] Length = 905 Score = 56.2 bits (134), Expect = 5e-06 Identities = 50/136 (36%), Positives = 64/136 (47%), Gaps = 14/136 (10%) Frame = +1 Query: 1 RDLCLREAQKEGFYTVCPGHEIG------NEVSRAVISGSMPEIEEI----DALSSAPLA 150 R+LCLREA+KE F V H++ N R I S E E + AL PLA Sbjct: 498 RELCLREAEKEKFIYVRRPHDLNIPQGIINTRRRISIHQSASEKEYLPQARHALECMPLA 557 Query: 151 RSLILDLDGRTVSPLIFKALRTLGS---YITYDEF-IDKVHQFVNSRFFSFNIRKTKFPS 318 RSLI+ G S F+ LR L + Y+ F ++ V Q VNSRF + T Sbjct: 558 RSLIVGRQGVLPSLNYFRLLRVLNAVDKYLNDHVFSLEAVFQLVNSRFIAI----TSDRD 613 Query: 319 LKTEFPSLIWQFWNLR 366 +FPS I WNL+ Sbjct: 614 QNADFPSSINLLWNLQ 629 >gb|EYU21838.1| hypothetical protein MIMGU_mgv1a001107mg [Mimulus guttatus] Length = 888 Score = 56.2 bits (134), Expect = 5e-06 Identities = 47/138 (34%), Positives = 64/138 (46%), Gaps = 16/138 (11%) Frame = +1 Query: 1 RDLCLREAQKEGFYTVCPGHEIG-------NEVSRAVISGSMPEIEEIDALSSAPLARSL 159 R+LCLREA+KE F V H++ N R I S E E + AL S PL RSL Sbjct: 476 RELCLREAEKEKFLYVRIPHDLNNVPQGVINTQRRIGIHQSTSEPEALYALQSMPLVRSL 535 Query: 160 ILDLDGRTVSPLIFKALRTLGSY---------ITYDEFIDKVHQFVNSRFFSFNIRKTKF 312 I + G + L F+ LR L + Y I+ V + NSRF + + + Sbjct: 536 ICEFKG-VLPTLDFRLLRVLKAVDKHLYSEEKRQYKYPIEVVFRLFNSRFIAIRVDSRQN 594 Query: 313 PSLKTEFPSLIWQFWNLR 366 P +FPS + WNL+ Sbjct: 595 P----QFPSSVNLLWNLQ 608 >gb|EYU35738.1| hypothetical protein MIMGU_mgv1a020172mg, partial [Mimulus guttatus] Length = 647 Score = 55.8 bits (133), Expect = 6e-06 Identities = 49/136 (36%), Positives = 64/136 (47%), Gaps = 14/136 (10%) Frame = +1 Query: 1 RDLCLREAQKEGFYTVCPGHEIG------NEVSRAVISGSMPEIEEI----DALSSAPLA 150 R+LCLREA+KE F V H++ N R I S E + + AL PLA Sbjct: 370 RELCLREAEKEKFIYVRRPHDLNIPQGIINTRRRITIHQSASEKDYLPQARHALECMPLA 429 Query: 151 RSLILDLDGRTVSPLIFKALRTLGS---YITYDEF-IDKVHQFVNSRFFSFNIRKTKFPS 318 RSLI+ G S F+ LR L + Y+ F ++ V Q VNSRF + T Sbjct: 430 RSLIVGRQGVLPSLNYFRLLRVLNAVDKYLNDHVFSLEAVFQLVNSRFIAI----TSDRD 485 Query: 319 LKTEFPSLIWQFWNLR 366 +FPS I WNL+ Sbjct: 486 QNADFPSSINLLWNLQ 501