BLASTX nr result
ID: Mentha28_contig00027718
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Mentha28_contig00027718 (458 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EYU43174.1| hypothetical protein MIMGU_mgv1a014963mg [Mimulus... 56 6e-06 >gb|EYU43174.1| hypothetical protein MIMGU_mgv1a014963mg [Mimulus guttatus] gi|604344421|gb|EYU43175.1| hypothetical protein MIMGU_mgv1a014963mg [Mimulus guttatus] Length = 172 Score = 55.8 bits (133), Expect = 6e-06 Identities = 23/39 (58%), Positives = 35/39 (89%) Frame = -2 Query: 118 MYGVRQTFNQMYRKLHTMSHESPSDTLRRKVAELEKKRK 2 M GVR+T +Q+ RK+HT+SH+ PSDTL+RK+A+LEK+++ Sbjct: 1 MNGVRRTLSQICRKVHTLSHDGPSDTLKRKLADLEKEKR 39