BLASTX nr result
ID: Mentha28_contig00026802
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Mentha28_contig00026802 (453 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EYU45637.1| hypothetical protein MIMGU_mgv1a007414mg [Mimulus... 70 3e-10 gb|EPS64537.1| hypothetical protein M569_10245 [Genlisea aurea] 64 3e-08 gb|EYU41508.1| hypothetical protein MIMGU_mgv1a013067mg [Mimulus... 60 3e-07 ref|XP_006359904.1| PREDICTED: cyclin-T1-4-like isoform X1 [Sola... 58 2e-06 >gb|EYU45637.1| hypothetical protein MIMGU_mgv1a007414mg [Mimulus guttatus] Length = 408 Score = 70.1 bits (170), Expect = 3e-10 Identities = 29/35 (82%), Positives = 33/35 (94%) Frame = +3 Query: 3 AKFLNMNLTSCHSIWNEFHTPPSILKDVAHQLMEL 107 AKFLNMNL SCH++WN FHTPPS+L+DVAHQLMEL Sbjct: 373 AKFLNMNLPSCHNVWNGFHTPPSVLRDVAHQLMEL 407 >gb|EPS64537.1| hypothetical protein M569_10245 [Genlisea aurea] Length = 408 Score = 63.5 bits (153), Expect = 3e-08 Identities = 26/34 (76%), Positives = 30/34 (88%) Frame = +3 Query: 3 AKFLNMNLTSCHSIWNEFHTPPSILKDVAHQLME 104 +KFLNMNL S H +WNEFHTPPS+LKD+A QLME Sbjct: 360 SKFLNMNLASAHMVWNEFHTPPSVLKDIAKQLME 393 >gb|EYU41508.1| hypothetical protein MIMGU_mgv1a013067mg [Mimulus guttatus] Length = 231 Score = 60.1 bits (144), Expect = 3e-07 Identities = 27/35 (77%), Positives = 29/35 (82%) Frame = +3 Query: 3 AKFLNMNLTSCHSIWNEFHTPPSILKDVAHQLMEL 107 AKFLNMNL S +W EFHT PS+LKDVAHQLMEL Sbjct: 196 AKFLNMNLASSDDVWLEFHTTPSVLKDVAHQLMEL 230 >ref|XP_006359904.1| PREDICTED: cyclin-T1-4-like isoform X1 [Solanum tuberosum] Length = 400 Score = 57.8 bits (138), Expect = 2e-06 Identities = 24/36 (66%), Positives = 30/36 (83%) Frame = +3 Query: 3 AKFLNMNLTSCHSIWNEFHTPPSILKDVAHQLMELF 110 +KFLNM+ S HS+W EF TPP++L+DVA QLMELF Sbjct: 365 SKFLNMDFASHHSVWKEFQTPPNVLRDVAQQLMELF 400