BLASTX nr result
ID: Mentha28_contig00026671
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Mentha28_contig00026671 (363 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EPS67423.1| hypothetical protein M569_07352 [Genlisea aurea] 43 4e-06 gb|EYU21523.1| hypothetical protein MIMGU_mgv1a019717mg, partial... 45 5e-06 >gb|EPS67423.1| hypothetical protein M569_07352 [Genlisea aurea] Length = 385 Score = 43.1 bits (100), Expect(2) = 4e-06 Identities = 19/38 (50%), Positives = 27/38 (71%) Frame = -3 Query: 199 LLTVDQQLSTGPETKAWVETYASDIPQFRRDFGPSYVQ 86 LL DQQL++G ET++WV YASD F+ DFG + ++ Sbjct: 326 LLFSDQQLTSGEETESWVRRYASDTTLFQTDFGRAMIK 363 Score = 33.1 bits (74), Expect(2) = 4e-06 Identities = 17/28 (60%), Positives = 20/28 (71%), Gaps = 2/28 (7%) Frame = -1 Query: 102 GQAMFKLSHLQ--VSKKGEVRLNCRKVN 25 G+AM KLS LQ S G+VRLNC +VN Sbjct: 358 GRAMIKLSSLQNATSSTGQVRLNCSRVN 385 >gb|EYU21523.1| hypothetical protein MIMGU_mgv1a019717mg, partial [Mimulus guttatus] Length = 348 Score = 45.1 bits (105), Expect(2) = 5e-06 Identities = 20/35 (57%), Positives = 26/35 (74%) Frame = -3 Query: 205 KRLLTVDQQLSTGPETKAWVETYASDIPQFRRDFG 101 K LL VDQQL++ E + WV+ YASD+ F+RDFG Sbjct: 289 KGLLFVDQQLTSMAEAQVWVQAYASDLSLFKRDFG 323 Score = 30.8 bits (68), Expect(2) = 5e-06 Identities = 17/26 (65%), Positives = 18/26 (69%), Gaps = 2/26 (7%) Frame = -1 Query: 102 GQAMFKLS--HLQVSKKGEVRLNCRK 31 G AM KLS HL + GEVRLNCRK Sbjct: 323 GLAMMKLSNLHLLNASVGEVRLNCRK 348