BLASTX nr result
ID: Mentha28_contig00026513
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Mentha28_contig00026513 (539 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_006586840.1| PREDICTED: WPP domain-associated protein-lik... 110 2e-22 ref|XP_006353010.1| PREDICTED: WPP domain-associated protein-lik... 110 3e-22 emb|CBI31022.3| unnamed protein product [Vitis vinifera] 109 4e-22 ref|XP_002264075.1| PREDICTED: WPP domain-associated protein-lik... 109 4e-22 ref|XP_003547328.1| PREDICTED: WPP domain-associated protein-lik... 107 1e-21 ref|XP_006367005.1| PREDICTED: WPP domain-associated protein-lik... 107 2e-21 ref|XP_004231564.1| PREDICTED: WPP domain-associated protein-lik... 107 2e-21 ref|XP_002523187.1| Early endosome antigen, putative [Ricinus co... 105 5e-21 ref|XP_007147479.1| hypothetical protein PHAVU_006G128000g [Phas... 105 9e-21 ref|XP_007022891.1| Early endosome antigen, putative isoform 1 [... 105 9e-21 ref|XP_004158693.1| PREDICTED: WPP domain-associated protein-lik... 105 9e-21 ref|XP_004134899.1| PREDICTED: WPP domain-associated protein-lik... 105 9e-21 ref|XP_004486461.1| PREDICTED: WPP domain-associated protein-lik... 103 2e-20 ref|XP_002879512.1| hypothetical protein ARALYDRAFT_482437 [Arab... 102 8e-20 ref|XP_006845998.1| hypothetical protein AMTR_s00155p00053970 [A... 101 1e-19 ref|XP_006293684.1| hypothetical protein CARUB_v10022643mg [Caps... 101 1e-19 ref|XP_006377961.1| hypothetical protein POPTR_0011s16730g [Popu... 101 1e-19 ref|NP_181020.2| myosin heavy chain-related [Arabidopsis thalian... 100 2e-19 ref|XP_006307106.1| hypothetical protein CARUB_v10008693mg [Caps... 100 4e-19 gb|EPS66486.1| hypothetical protein M569_08292 [Genlisea aurea] 99 7e-19 >ref|XP_006586840.1| PREDICTED: WPP domain-associated protein-like isoform X1 [Glycine max] Length = 854 Score = 110 bits (276), Expect = 2e-22 Identities = 52/77 (67%), Positives = 66/77 (85%) Frame = +3 Query: 3 NLLRSSELIYKQKL*QKNTHLQMAESEVDLLGDEVDALLRLLEKIYVALDHYHPVLKHYS 182 N+L++ ++YKQKL K++ L AE+EVDLLGDEVD LL LLEKIY+ALDHY P+L+HY Sbjct: 774 NVLKTMGMVYKQKLETKSSDLSKAEAEVDLLGDEVDTLLSLLEKIYIALDHYSPILQHYP 833 Query: 183 GIVEVLELVRRELTGES 233 GI+E+LELVRRELTG+S Sbjct: 834 GIIEILELVRRELTGDS 850 >ref|XP_006353010.1| PREDICTED: WPP domain-associated protein-like [Solanum tuberosum] Length = 902 Score = 110 bits (274), Expect = 3e-22 Identities = 52/80 (65%), Positives = 70/80 (87%) Frame = +3 Query: 3 NLLRSSELIYKQKL*QKNTHLQMAESEVDLLGDEVDALLRLLEKIYVALDHYHPVLKHYS 182 NLLR + L+Y+Q+L ++ + L++AE+EVDLLGDEVD LL L+EKIY+ALDHY PVL+HY Sbjct: 817 NLLRRTTLLYQQRLEKRCSDLKLAEAEVDLLGDEVDILLSLVEKIYIALDHYSPVLQHYP 876 Query: 183 GIVEVLELVRRELTGESTTL 242 GI+E+L+L++RELTGEST L Sbjct: 877 GIMEILKLIKRELTGESTKL 896 >emb|CBI31022.3| unnamed protein product [Vitis vinifera] Length = 807 Score = 109 bits (273), Expect = 4e-22 Identities = 52/78 (66%), Positives = 67/78 (85%) Frame = +3 Query: 3 NLLRSSELIYKQKL*QKNTHLQMAESEVDLLGDEVDALLRLLEKIYVALDHYHPVLKHYS 182 N+LR + L YKQ+L ++ + LQ AE+EVDLLGDEVDALL LLEKIY+ALDHY P+L+HY Sbjct: 727 NILRRTSLRYKQRLERRYSDLQKAETEVDLLGDEVDALLSLLEKIYIALDHYSPILQHYP 786 Query: 183 GIVEVLELVRRELTGEST 236 G++E+L+LVRREL+ EST Sbjct: 787 GVIEILKLVRRELSAEST 804 >ref|XP_002264075.1| PREDICTED: WPP domain-associated protein-like [Vitis vinifera] Length = 902 Score = 109 bits (273), Expect = 4e-22 Identities = 52/78 (66%), Positives = 67/78 (85%) Frame = +3 Query: 3 NLLRSSELIYKQKL*QKNTHLQMAESEVDLLGDEVDALLRLLEKIYVALDHYHPVLKHYS 182 N+LR + L YKQ+L ++ + LQ AE+EVDLLGDEVDALL LLEKIY+ALDHY P+L+HY Sbjct: 822 NILRRTSLRYKQRLERRYSDLQKAETEVDLLGDEVDALLSLLEKIYIALDHYSPILQHYP 881 Query: 183 GIVEVLELVRRELTGEST 236 G++E+L+LVRREL+ EST Sbjct: 882 GVIEILKLVRRELSAEST 899 >ref|XP_003547328.1| PREDICTED: WPP domain-associated protein-like [Glycine max] Length = 854 Score = 107 bits (268), Expect = 1e-21 Identities = 51/77 (66%), Positives = 66/77 (85%) Frame = +3 Query: 3 NLLRSSELIYKQKL*QKNTHLQMAESEVDLLGDEVDALLRLLEKIYVALDHYHPVLKHYS 182 N+L++ L++KQ+L K++ L AE+EVDLLGDEVD LL LLEKIY+ALDHY P+L+HY Sbjct: 774 NVLKTMGLVHKQRLETKSSDLLKAEAEVDLLGDEVDTLLSLLEKIYIALDHYSPILQHYP 833 Query: 183 GIVEVLELVRRELTGES 233 GI+E+LELVRRELTG+S Sbjct: 834 GIIEILELVRRELTGDS 850 >ref|XP_006367005.1| PREDICTED: WPP domain-associated protein-like isoform X1 [Solanum tuberosum] gi|565403106|ref|XP_006367006.1| PREDICTED: WPP domain-associated protein-like isoform X2 [Solanum tuberosum] Length = 916 Score = 107 bits (267), Expect = 2e-21 Identities = 51/77 (66%), Positives = 67/77 (87%) Frame = +3 Query: 3 NLLRSSELIYKQKL*QKNTHLQMAESEVDLLGDEVDALLRLLEKIYVALDHYHPVLKHYS 182 N LR + L+Y+Q+L ++ + LQMAE+EVDLLGDEVD LLRLLEKIY+ALDHY PVL+HY Sbjct: 835 NSLRRTVLLYRQRLEKRCSDLQMAEAEVDLLGDEVDTLLRLLEKIYIALDHYLPVLQHYP 894 Query: 183 GIVEVLELVRRELTGES 233 GI+E+L+L+R+EL G+S Sbjct: 895 GIIEILKLIRKELWGDS 911 >ref|XP_004231564.1| PREDICTED: WPP domain-associated protein-like [Solanum lycopersicum] Length = 900 Score = 107 bits (267), Expect = 2e-21 Identities = 51/77 (66%), Positives = 67/77 (87%) Frame = +3 Query: 3 NLLRSSELIYKQKL*QKNTHLQMAESEVDLLGDEVDALLRLLEKIYVALDHYHPVLKHYS 182 N LR + L+Y+Q+L ++ + LQMAE+EVDLLGDEVD LLRLLEKIY+ALDHY PVL+HY Sbjct: 819 NSLRRTVLLYRQRLEKRCSDLQMAEAEVDLLGDEVDTLLRLLEKIYIALDHYLPVLQHYP 878 Query: 183 GIVEVLELVRRELTGES 233 GI+E+L+L+R+EL G+S Sbjct: 879 GIIEILKLIRKELWGDS 895 >ref|XP_002523187.1| Early endosome antigen, putative [Ricinus communis] gi|223537594|gb|EEF39218.1| Early endosome antigen, putative [Ricinus communis] Length = 903 Score = 105 bits (263), Expect = 5e-21 Identities = 53/77 (68%), Positives = 65/77 (84%) Frame = +3 Query: 3 NLLRSSELIYKQKL*QKNTHLQMAESEVDLLGDEVDALLRLLEKIYVALDHYHPVLKHYS 182 N LR + L+YKQKL + + L+ AE+EVDLLGDEVD LL LLEKIY+ALDHY P+L+HY Sbjct: 823 NKLRRTGLMYKQKLEVRCSDLRKAEAEVDLLGDEVDTLLSLLEKIYIALDHYSPILQHYP 882 Query: 183 GIVEVLELVRRELTGES 233 GI+EVL+LVRREL+GES Sbjct: 883 GIMEVLKLVRRELSGES 899 >ref|XP_007147479.1| hypothetical protein PHAVU_006G128000g [Phaseolus vulgaris] gi|561020702|gb|ESW19473.1| hypothetical protein PHAVU_006G128000g [Phaseolus vulgaris] Length = 862 Score = 105 bits (261), Expect = 9e-21 Identities = 50/80 (62%), Positives = 66/80 (82%) Frame = +3 Query: 3 NLLRSSELIYKQKL*QKNTHLQMAESEVDLLGDEVDALLRLLEKIYVALDHYHPVLKHYS 182 N+L++ +YKQ+L +++ L AE+EVDLLGDEVD LLRLLEKIY+ALDHY P+L+HY Sbjct: 782 NVLKTMGSVYKQQLETRSSDLVKAETEVDLLGDEVDTLLRLLEKIYIALDHYSPILQHYP 841 Query: 183 GIVEVLELVRRELTGESTTL 242 GI+E+L LVRREL+G+S L Sbjct: 842 GIIEILALVRRELSGDSRKL 861 >ref|XP_007022891.1| Early endosome antigen, putative isoform 1 [Theobroma cacao] gi|508778257|gb|EOY25513.1| Early endosome antigen, putative isoform 1 [Theobroma cacao] Length = 882 Score = 105 bits (261), Expect = 9e-21 Identities = 50/78 (64%), Positives = 65/78 (83%) Frame = +3 Query: 3 NLLRSSELIYKQKL*QKNTHLQMAESEVDLLGDEVDALLRLLEKIYVALDHYHPVLKHYS 182 N+L+ L YKQ L ++ + L+ AE+EVDLLGD+VD LL LLEKIY+ALDHY P+LKHY+ Sbjct: 802 NVLKRKGLHYKQNLERRCSDLEKAETEVDLLGDQVDVLLGLLEKIYIALDHYSPILKHYT 861 Query: 183 GIVEVLELVRRELTGEST 236 G++E+L LVRREL+GEST Sbjct: 862 GVMEILNLVRRELSGEST 879 >ref|XP_004158693.1| PREDICTED: WPP domain-associated protein-like [Cucumis sativus] Length = 852 Score = 105 bits (261), Expect = 9e-21 Identities = 50/77 (64%), Positives = 66/77 (85%) Frame = +3 Query: 3 NLLRSSELIYKQKL*QKNTHLQMAESEVDLLGDEVDALLRLLEKIYVALDHYHPVLKHYS 182 ++++ LIYKQ+L ++ + LQ AE+EVDLLGDEVDALLRLLEK+Y+ALDHY P+LKHY Sbjct: 772 SMVKRDGLIYKQRLEKRCSDLQKAEAEVDLLGDEVDALLRLLEKMYIALDHYSPILKHYP 831 Query: 183 GIVEVLELVRRELTGES 233 GIVE L+LV+REL G++ Sbjct: 832 GIVETLKLVKRELRGDT 848 >ref|XP_004134899.1| PREDICTED: WPP domain-associated protein-like [Cucumis sativus] Length = 881 Score = 105 bits (261), Expect = 9e-21 Identities = 50/77 (64%), Positives = 66/77 (85%) Frame = +3 Query: 3 NLLRSSELIYKQKL*QKNTHLQMAESEVDLLGDEVDALLRLLEKIYVALDHYHPVLKHYS 182 ++++ LIYKQ+L ++ + LQ AE+EVDLLGDEVDALLRLLEK+Y+ALDHY P+LKHY Sbjct: 801 SMVKRDGLIYKQRLEKRCSDLQKAEAEVDLLGDEVDALLRLLEKMYIALDHYSPILKHYP 860 Query: 183 GIVEVLELVRRELTGES 233 GIVE L+LV+REL G++ Sbjct: 861 GIVETLKLVKRELRGDT 877 >ref|XP_004486461.1| PREDICTED: WPP domain-associated protein-like [Cicer arietinum] Length = 857 Score = 103 bits (258), Expect = 2e-20 Identities = 51/75 (68%), Positives = 63/75 (84%) Frame = +3 Query: 9 LRSSELIYKQKL*QKNTHLQMAESEVDLLGDEVDALLRLLEKIYVALDHYHPVLKHYSGI 188 L+++ L+YKQ+ K + L AE+EVDLLGDEVD LLRLL KIYVALDHY P+L+HY GI Sbjct: 779 LKTTGLVYKQRFETKCSDLAKAEAEVDLLGDEVDTLLRLLGKIYVALDHYSPILQHYPGI 838 Query: 189 VEVLELVRRELTGES 233 +EVLELVRREL+G+S Sbjct: 839 IEVLELVRRELSGDS 853 >ref|XP_002879512.1| hypothetical protein ARALYDRAFT_482437 [Arabidopsis lyrata subsp. lyrata] gi|297325351|gb|EFH55771.1| hypothetical protein ARALYDRAFT_482437 [Arabidopsis lyrata subsp. lyrata] Length = 834 Score = 102 bits (253), Expect = 8e-20 Identities = 50/77 (64%), Positives = 61/77 (79%) Frame = +3 Query: 3 NLLRSSELIYKQKL*QKNTHLQMAESEVDLLGDEVDALLRLLEKIYVALDHYHPVLKHYS 182 N ++ YKQ+L +K LQ AE+EVDLLGDEV+ LL LLEKIY+ALDHY P+LKHY Sbjct: 753 NEVKGKASTYKQRLEKKCCDLQKAETEVDLLGDEVETLLDLLEKIYIALDHYSPILKHYP 812 Query: 183 GIVEVLELVRRELTGES 233 GI+E+L LVRREL+GES Sbjct: 813 GIIEILRLVRRELSGES 829 >ref|XP_006845998.1| hypothetical protein AMTR_s00155p00053970 [Amborella trichopoda] gi|548848754|gb|ERN07673.1| hypothetical protein AMTR_s00155p00053970 [Amborella trichopoda] Length = 907 Score = 101 bits (252), Expect = 1e-19 Identities = 49/76 (64%), Positives = 61/76 (80%) Frame = +3 Query: 3 NLLRSSELIYKQKL*QKNTHLQMAESEVDLLGDEVDALLRLLEKIYVALDHYHPVLKHYS 182 N LR L+YKQ L ++ + LQ AE EVDLLGDEVD LL LLEKIY+ALDHY P+L+HY Sbjct: 827 NSLRKKNLLYKQGLERRYSDLQKAEVEVDLLGDEVDTLLSLLEKIYIALDHYSPILQHYP 886 Query: 183 GIVEVLELVRRELTGE 230 GI+E+L+L++REL GE Sbjct: 887 GIMEILKLIQRELKGE 902 >ref|XP_006293684.1| hypothetical protein CARUB_v10022643mg [Capsella rubella] gi|565471766|ref|XP_006293685.1| hypothetical protein CARUB_v10022643mg [Capsella rubella] gi|482562392|gb|EOA26582.1| hypothetical protein CARUB_v10022643mg [Capsella rubella] gi|482562393|gb|EOA26583.1| hypothetical protein CARUB_v10022643mg [Capsella rubella] Length = 829 Score = 101 bits (252), Expect = 1e-19 Identities = 49/68 (72%), Positives = 59/68 (86%) Frame = +3 Query: 30 YKQKL*QKNTHLQMAESEVDLLGDEVDALLRLLEKIYVALDHYHPVLKHYSGIVEVLELV 209 YKQ+L +K LQ AE+EVDLLGDEV+ LL LLEKIY+ALDHY P+LKHY GI+E+L+LV Sbjct: 757 YKQRLEKKCCDLQKAEAEVDLLGDEVETLLDLLEKIYIALDHYSPILKHYPGIIEILKLV 816 Query: 210 RRELTGES 233 RREL+GES Sbjct: 817 RRELSGES 824 >ref|XP_006377961.1| hypothetical protein POPTR_0011s16730g [Populus trichocarpa] gi|550328567|gb|ERP55758.1| hypothetical protein POPTR_0011s16730g [Populus trichocarpa] Length = 875 Score = 101 bits (251), Expect = 1e-19 Identities = 50/76 (65%), Positives = 61/76 (80%) Frame = +3 Query: 6 LLRSSELIYKQKL*QKNTHLQMAESEVDLLGDEVDALLRLLEKIYVALDHYHPVLKHYSG 185 +L ++KQKL + + LQ AE+EVDLLGDEV+ LL LLEKIY+ALDHY P+LKHYSG Sbjct: 796 ILTRMGFLHKQKLESRCSDLQKAEAEVDLLGDEVENLLSLLEKIYIALDHYSPILKHYSG 855 Query: 186 IVEVLELVRRELTGES 233 I E+L+LVRREL GES Sbjct: 856 ITEILKLVRRELNGES 871 >ref|NP_181020.2| myosin heavy chain-related [Arabidopsis thaliana] gi|205830840|sp|O64584.2|WAP_ARATH RecName: Full=WPP domain-associated protein gi|330253920|gb|AEC09014.1| myosin heavy chain-related [Arabidopsis thaliana] Length = 825 Score = 100 bits (249), Expect = 2e-19 Identities = 49/77 (63%), Positives = 61/77 (79%) Frame = +3 Query: 3 NLLRSSELIYKQKL*QKNTHLQMAESEVDLLGDEVDALLRLLEKIYVALDHYHPVLKHYS 182 N ++ YKQ+L +K L+ AE+EVDLLGDEV+ LL LLEKIY+ALDHY P+LKHY Sbjct: 744 NEVKGKASTYKQRLEKKCCDLKKAEAEVDLLGDEVETLLDLLEKIYIALDHYSPILKHYP 803 Query: 183 GIVEVLELVRRELTGES 233 GI+E+L LVRREL+GES Sbjct: 804 GIIEILRLVRRELSGES 820 >ref|XP_006307106.1| hypothetical protein CARUB_v10008693mg [Capsella rubella] gi|482575817|gb|EOA40004.1| hypothetical protein CARUB_v10008693mg [Capsella rubella] Length = 577 Score = 99.8 bits (247), Expect = 4e-19 Identities = 48/79 (60%), Positives = 63/79 (79%) Frame = +3 Query: 9 LRSSELIYKQKL*QKNTHLQMAESEVDLLGDEVDALLRLLEKIYVALDHYHPVLKHYSGI 188 L+ E I+KQ L +K LQ AE+EVDLLG+E+++ + LLEKIY+ALDHY P+LKHY GI Sbjct: 497 LKVRESIFKQLLEKKTCDLQKAETEVDLLGNEIESFMDLLEKIYIALDHYSPILKHYPGI 556 Query: 189 VEVLELVRRELTGESTTLS 245 +E+L+LVRREL G+S LS Sbjct: 557 IEILKLVRRELRGQSKRLS 575 >gb|EPS66486.1| hypothetical protein M569_08292 [Genlisea aurea] Length = 827 Score = 99.0 bits (245), Expect = 7e-19 Identities = 49/75 (65%), Positives = 61/75 (81%) Frame = +3 Query: 9 LRSSELIYKQKL*QKNTHLQMAESEVDLLGDEVDALLRLLEKIYVALDHYHPVLKHYSGI 188 LR EL+YKQ L ++ L++AE+EVDLLGD+VD L LLEKIY+ L HY PVL HYSGI Sbjct: 655 LRRRELMYKQVLERRCADLELAEAEVDLLGDQVDVLSCLLEKIYIGLKHYAPVLVHYSGI 714 Query: 189 VEVLELVRRELTGES 233 +E+LEL+RREL+GES Sbjct: 715 MEILELIRRELSGES 729