BLASTX nr result
ID: Mentha28_contig00025749
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Mentha28_contig00025749 (453 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EYU37440.1| hypothetical protein MIMGU_mgv11b003028mg [Mimulu... 60 2e-07 >gb|EYU37440.1| hypothetical protein MIMGU_mgv11b003028mg [Mimulus guttatus] Length = 571 Score = 60.5 bits (145), Expect = 2e-07 Identities = 35/67 (52%), Positives = 45/67 (67%), Gaps = 2/67 (2%) Frame = -3 Query: 451 EAEISTEEMDATPAKKVAIEAEFWRPNECD--SNAETIEGYLMIDGVWKKVEEEELHAIA 278 EAEI T EMD T K++ I AE + D S E +G L+IDGVWKKV EEEL AIA Sbjct: 505 EAEICTAEMDDTRVKRLEIVAEDCVMQDQDDVSEEEGTKGCLVIDGVWKKVGEEELSAIA 564 Query: 277 SAVKLMI 257 SA+++++ Sbjct: 565 SAIRVLV 571