BLASTX nr result
ID: Mentha28_contig00025636
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Mentha28_contig00025636 (566 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EYU19694.1| hypothetical protein MIMGU_mgv11b009143mg [Mimulu... 65 1e-08 >gb|EYU19694.1| hypothetical protein MIMGU_mgv11b009143mg [Mimulus guttatus] Length = 295 Score = 65.1 bits (157), Expect = 1e-08 Identities = 36/65 (55%), Positives = 47/65 (72%), Gaps = 2/65 (3%) Frame = -3 Query: 528 HQTDLSEVHDKHSNKVIGTYKKKQS--DLSLENGTSSVILIKSIHNSKNNRPSISKSFPK 355 ++ + SE+H+K S KV G KKK+S DL+ E+G +SVILIKSIH S N SISKS+ K Sbjct: 230 NEMNKSEIHEKASKKVGGILKKKRSRSDLNSEDGNASVILIKSIHTSNKNGTSISKSYLK 289 Query: 354 FKQKR 340 KQK+ Sbjct: 290 SKQKK 294