BLASTX nr result
ID: Mentha28_contig00025338
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Mentha28_contig00025338 (381 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EYU42642.1| hypothetical protein MIMGU_mgv1a0113511mg, partia... 70 3e-10 >gb|EYU42642.1| hypothetical protein MIMGU_mgv1a0113511mg, partial [Mimulus guttatus] Length = 80 Score = 70.1 bits (170), Expect = 3e-10 Identities = 38/69 (55%), Positives = 47/69 (68%) Frame = +2 Query: 137 MDEDRIVLVLAKTSELRSKIISCIHKTASNVDRESGEREAKESEASPXXXXXXXXXXXXX 316 MDE+RIVLVLAKTS+L+SKII+CIHKT SN D E+ + ++ ESEA P Sbjct: 1 MDEERIVLVLAKTSDLKSKIINCIHKT-SNADNEANQTDSMESEAKPDAEIEEDDNEEET 59 Query: 317 XTLLNIKDA 343 +LL IKDA Sbjct: 60 ESLLGIKDA 68