BLASTX nr result
ID: Mentha28_contig00025273
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Mentha28_contig00025273 (356 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EYU30545.1| hypothetical protein MIMGU_mgv1a006807mg [Mimulus... 67 3e-09 gb|EYU30544.1| hypothetical protein MIMGU_mgv1a006682mg [Mimulus... 65 8e-09 gb|EYU37389.1| hypothetical protein MIMGU_mgv1a0083262mg, partia... 64 2e-08 >gb|EYU30545.1| hypothetical protein MIMGU_mgv1a006807mg [Mimulus guttatus] Length = 430 Score = 67.0 bits (162), Expect = 3e-09 Identities = 32/61 (52%), Positives = 40/61 (65%), Gaps = 6/61 (9%) Frame = -1 Query: 353 IPKKHTHSLHFK------LDYLDWLANEVGMGRVHETTRSLLGTYLKFIMGGGKWSHRDW 192 IPK HTHSL K LDYLDWLA+EVG+ V E TR + YLK+++ G W +R+W Sbjct: 364 IPKHHTHSLVHKNIPTSQLDYLDWLASEVGLAGVDEQTRFIQKCYLKYVIDNGGWRNREW 423 Query: 191 E 189 E Sbjct: 424 E 424 >gb|EYU30544.1| hypothetical protein MIMGU_mgv1a006682mg [Mimulus guttatus] Length = 435 Score = 65.5 bits (158), Expect = 8e-09 Identities = 27/56 (48%), Positives = 38/56 (67%) Frame = -1 Query: 356 GIPKKHTHSLHFKLDYLDWLANEVGMGRVHETTRSLLGTYLKFIMGGGKWSHRDWE 189 G+PK HTHSL + DY DWLA+ +G+ V E TRS+ +Y KF++ W +R+WE Sbjct: 368 GVPKHHTHSLGHEFDYADWLASRMGLQGVDERTRSIQKSYYKFLVKNRGWRNREWE 423 >gb|EYU37389.1| hypothetical protein MIMGU_mgv1a0083262mg, partial [Mimulus guttatus] Length = 177 Score = 64.3 bits (155), Expect = 2e-08 Identities = 26/56 (46%), Positives = 38/56 (67%) Frame = -1 Query: 356 GIPKKHTHSLHFKLDYLDWLANEVGMGRVHETTRSLLGTYLKFIMGGGKWSHRDWE 189 G+PK HTHSL + DY DWL++ +G+ V E TRS+ +Y KF++ W +R+WE Sbjct: 110 GVPKHHTHSLGHEFDYADWLSSRMGLQGVDERTRSIQKSYYKFLVKNRGWRNREWE 165