BLASTX nr result
ID: Mentha28_contig00025135
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Mentha28_contig00025135 (519 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EYU39515.1| hypothetical protein MIMGU_mgv1a023519mg [Mimulus... 59 5e-07 >gb|EYU39515.1| hypothetical protein MIMGU_mgv1a023519mg [Mimulus guttatus] Length = 817 Score = 59.3 bits (142), Expect = 5e-07 Identities = 29/47 (61%), Positives = 34/47 (72%) Frame = -2 Query: 518 IPDSIGEIPTLKLIEVKNCRNSLADCVRLMQDEQQQYSNGDDDDVFQ 378 IPD IGEIPTL+LIE+KNCR +LAD +Q+EQQ Y N D FQ Sbjct: 767 IPDGIGEIPTLELIELKNCRKTLADSAERIQEEQQDYGN----DAFQ 809