BLASTX nr result
ID: Mentha28_contig00024983
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Mentha28_contig00024983 (355 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value emb|CAN61223.1| hypothetical protein VITISV_038806 [Vitis vinifera] 75 1e-11 ref|XP_002268954.2| PREDICTED: transmembrane protein 184C-like [... 73 4e-11 emb|CBI23472.3| unnamed protein product [Vitis vinifera] 73 4e-11 ref|XP_006347105.1| PREDICTED: transmembrane protein 184C-like i... 72 8e-11 ref|XP_004233821.1| PREDICTED: uncharacterized protein LOC101268... 72 8e-11 ref|XP_007211718.1| hypothetical protein PRUPE_ppa009378mg [Prun... 71 2e-10 ref|XP_006467880.1| PREDICTED: transmembrane protein 184C-like [... 69 7e-10 ref|XP_006449236.1| hypothetical protein CICLE_v10016111mg [Citr... 69 7e-10 ref|XP_002521429.1| conserved hypothetical protein [Ricinus comm... 69 9e-10 ref|XP_007025760.1| Uncharacterized protein isoform 2 [Theobroma... 67 3e-09 ref|XP_007025759.1| Uncharacterized protein isoform 1 [Theobroma... 67 3e-09 gb|EYU27912.1| hypothetical protein MIMGU_mgv1a011064mg [Mimulus... 66 4e-09 ref|XP_004485717.1| PREDICTED: transmembrane protein 184A-like [... 62 8e-08 ref|XP_006841771.1| hypothetical protein AMTR_s00003p00265310 [A... 61 1e-07 ref|XP_004146586.1| PREDICTED: transmembrane protein 184C-like [... 61 1e-07 gb|AFK39908.1| unknown [Medicago truncatula] 61 1e-07 ref|XP_003593452.1| Transmembrane protein 184C [Medicago truncat... 61 1e-07 gb|EXB51811.1| hypothetical protein L484_006384 [Morus notabilis] 61 2e-07 ref|XP_007148236.1| hypothetical protein PHAVU_006G191300g [Phas... 60 2e-07 ref|XP_006417379.1| hypothetical protein EUTSA_v10008344mg [Eutr... 60 3e-07 >emb|CAN61223.1| hypothetical protein VITISV_038806 [Vitis vinifera] Length = 295 Score = 74.7 bits (182), Expect = 1e-11 Identities = 34/49 (69%), Positives = 41/49 (83%) Frame = +2 Query: 2 DTKNISAAIQNILVCVEMVIFAVLHQYAYYVTPYSGDFEAKLKLQKDRK 148 D ++I AIQN+LVCVEMV+F+VL QYAY+V PYSGD EAKLKL K R+ Sbjct: 247 DVEHIQEAIQNVLVCVEMVVFSVLQQYAYHVAPYSGDMEAKLKLSKKRE 295 >ref|XP_002268954.2| PREDICTED: transmembrane protein 184C-like [Vitis vinifera] Length = 295 Score = 73.2 bits (178), Expect = 4e-11 Identities = 33/49 (67%), Positives = 41/49 (83%) Frame = +2 Query: 2 DTKNISAAIQNILVCVEMVIFAVLHQYAYYVTPYSGDFEAKLKLQKDRK 148 D ++I AIQN+LVCVEMV+F+VL QYA++V PYSGD EAKLKL K R+ Sbjct: 247 DVEHIQEAIQNVLVCVEMVVFSVLQQYAFHVAPYSGDMEAKLKLSKKRE 295 >emb|CBI23472.3| unnamed protein product [Vitis vinifera] Length = 220 Score = 73.2 bits (178), Expect = 4e-11 Identities = 33/49 (67%), Positives = 41/49 (83%) Frame = +2 Query: 2 DTKNISAAIQNILVCVEMVIFAVLHQYAYYVTPYSGDFEAKLKLQKDRK 148 D ++I AIQN+LVCVEMV+F+VL QYA++V PYSGD EAKLKL K R+ Sbjct: 172 DVEHIQEAIQNVLVCVEMVVFSVLQQYAFHVAPYSGDMEAKLKLSKKRE 220 >ref|XP_006347105.1| PREDICTED: transmembrane protein 184C-like isoform X1 [Solanum tuberosum] gi|565360704|ref|XP_006347106.1| PREDICTED: transmembrane protein 184C-like isoform X2 [Solanum tuberosum] gi|565360706|ref|XP_006347107.1| PREDICTED: transmembrane protein 184C-like isoform X3 [Solanum tuberosum] Length = 294 Score = 72.0 bits (175), Expect = 8e-11 Identities = 31/47 (65%), Positives = 40/47 (85%) Frame = +2 Query: 2 DTKNISAAIQNILVCVEMVIFAVLHQYAYYVTPYSGDFEAKLKLQKD 142 D +++ AIQN+L+CVEMV F+V+ QYAY+V PYSGD EAKLKL+KD Sbjct: 247 DVEHLQEAIQNVLICVEMVFFSVMQQYAYHVAPYSGDVEAKLKLKKD 293 >ref|XP_004233821.1| PREDICTED: uncharacterized protein LOC101268548 [Solanum lycopersicum] Length = 683 Score = 72.0 bits (175), Expect = 8e-11 Identities = 31/47 (65%), Positives = 40/47 (85%) Frame = +2 Query: 2 DTKNISAAIQNILVCVEMVIFAVLHQYAYYVTPYSGDFEAKLKLQKD 142 D +++ AIQN+L+CVEMV F+V+ QYAY+V PYSGD EAKLKL+KD Sbjct: 636 DVEHLQEAIQNVLICVEMVFFSVMQQYAYHVAPYSGDVEAKLKLKKD 682 >ref|XP_007211718.1| hypothetical protein PRUPE_ppa009378mg [Prunus persica] gi|462407583|gb|EMJ12917.1| hypothetical protein PRUPE_ppa009378mg [Prunus persica] Length = 295 Score = 70.9 bits (172), Expect = 2e-10 Identities = 30/49 (61%), Positives = 41/49 (83%) Frame = +2 Query: 2 DTKNISAAIQNILVCVEMVIFAVLHQYAYYVTPYSGDFEAKLKLQKDRK 148 D ++I AIQN+L+C+EMV+F+VL QYAY+V PYSGD E+K+KL K R+ Sbjct: 247 DVEHIEEAIQNVLICLEMVVFSVLQQYAYHVAPYSGDVESKMKLNKKRE 295 >ref|XP_006467880.1| PREDICTED: transmembrane protein 184C-like [Citrus sinensis] Length = 295 Score = 68.9 bits (167), Expect = 7e-10 Identities = 30/46 (65%), Positives = 39/46 (84%) Frame = +2 Query: 2 DTKNISAAIQNILVCVEMVIFAVLHQYAYYVTPYSGDFEAKLKLQK 139 D ++I+ AIQN+LVC+EMV+F+++ QYAY TPYSGD EAKLKL K Sbjct: 247 DVEHINEAIQNVLVCLEMVVFSIIQQYAYPATPYSGDVEAKLKLNK 292 >ref|XP_006449236.1| hypothetical protein CICLE_v10016111mg [Citrus clementina] gi|557551847|gb|ESR62476.1| hypothetical protein CICLE_v10016111mg [Citrus clementina] Length = 295 Score = 68.9 bits (167), Expect = 7e-10 Identities = 30/46 (65%), Positives = 39/46 (84%) Frame = +2 Query: 2 DTKNISAAIQNILVCVEMVIFAVLHQYAYYVTPYSGDFEAKLKLQK 139 D ++I+ AIQN+LVC+EMV+F+++ QYAY TPYSGD EAKLKL K Sbjct: 247 DVEHINEAIQNVLVCLEMVVFSIIQQYAYPATPYSGDVEAKLKLNK 292 >ref|XP_002521429.1| conserved hypothetical protein [Ricinus communis] gi|223539328|gb|EEF40919.1| conserved hypothetical protein [Ricinus communis] Length = 294 Score = 68.6 bits (166), Expect = 9e-10 Identities = 29/47 (61%), Positives = 39/47 (82%) Frame = +2 Query: 2 DTKNISAAIQNILVCVEMVIFAVLHQYAYYVTPYSGDFEAKLKLQKD 142 D ++I A+QN+LVC+EMV+F+VL QYAY+V PYSGD E K+KL K+ Sbjct: 247 DVEHIEEALQNVLVCLEMVVFSVLQQYAYHVAPYSGDIERKMKLNKN 293 >ref|XP_007025760.1| Uncharacterized protein isoform 2 [Theobroma cacao] gi|508781126|gb|EOY28382.1| Uncharacterized protein isoform 2 [Theobroma cacao] Length = 258 Score = 66.6 bits (161), Expect = 3e-09 Identities = 28/46 (60%), Positives = 39/46 (84%) Frame = +2 Query: 2 DTKNISAAIQNILVCVEMVIFAVLHQYAYYVTPYSGDFEAKLKLQK 139 D +++ A+QN+LVC+EMV+F+VL QYAY+V PYSG+ EAK+KL K Sbjct: 210 DVEHLEEALQNVLVCLEMVVFSVLQQYAYHVAPYSGEVEAKMKLGK 255 >ref|XP_007025759.1| Uncharacterized protein isoform 1 [Theobroma cacao] gi|590624999|ref|XP_007025761.1| Uncharacterized protein isoform 1 [Theobroma cacao] gi|508781125|gb|EOY28381.1| Uncharacterized protein isoform 1 [Theobroma cacao] gi|508781127|gb|EOY28383.1| Uncharacterized protein isoform 1 [Theobroma cacao] Length = 295 Score = 66.6 bits (161), Expect = 3e-09 Identities = 28/46 (60%), Positives = 39/46 (84%) Frame = +2 Query: 2 DTKNISAAIQNILVCVEMVIFAVLHQYAYYVTPYSGDFEAKLKLQK 139 D +++ A+QN+LVC+EMV+F+VL QYAY+V PYSG+ EAK+KL K Sbjct: 247 DVEHLEEALQNVLVCLEMVVFSVLQQYAYHVAPYSGEVEAKMKLGK 292 >gb|EYU27912.1| hypothetical protein MIMGU_mgv1a011064mg [Mimulus guttatus] Length = 293 Score = 66.2 bits (160), Expect = 4e-09 Identities = 27/46 (58%), Positives = 41/46 (89%) Frame = +2 Query: 2 DTKNISAAIQNILVCVEMVIFAVLHQYAYYVTPYSGDFEAKLKLQK 139 DT+++ AIQ+++VCVEMV+++VL QYAY+V+PYSGD E+KL+ +K Sbjct: 247 DTEHVGEAIQHVIVCVEMVLYSVLQQYAYHVSPYSGDLESKLRQRK 292 >ref|XP_004485717.1| PREDICTED: transmembrane protein 184A-like [Cicer arietinum] Length = 295 Score = 62.0 bits (149), Expect = 8e-08 Identities = 27/46 (58%), Positives = 36/46 (78%) Frame = +2 Query: 2 DTKNISAAIQNILVCVEMVIFAVLHQYAYYVTPYSGDFEAKLKLQK 139 D ++I A+QNILVC+EMV+F+VL QYAY+ +PYSG+ E LK K Sbjct: 247 DVEHIEEAMQNILVCIEMVVFSVLQQYAYHASPYSGEVEKMLKQNK 292 >ref|XP_006841771.1| hypothetical protein AMTR_s00003p00265310 [Amborella trichopoda] gi|548843792|gb|ERN03446.1| hypothetical protein AMTR_s00003p00265310 [Amborella trichopoda] Length = 298 Score = 61.2 bits (147), Expect = 1e-07 Identities = 29/49 (59%), Positives = 39/49 (79%) Frame = +2 Query: 2 DTKNISAAIQNILVCVEMVIFAVLHQYAYYVTPYSGDFEAKLKLQKDRK 148 D ++I A+QN+LVC+EMV+FAV+ QYAY+V PYSGD A K QK++K Sbjct: 250 DVEHIQEALQNVLVCLEMVVFAVIQQYAYHVAPYSGD--AFGKSQKEKK 296 >ref|XP_004146586.1| PREDICTED: transmembrane protein 184C-like [Cucumis sativus] gi|449488421|ref|XP_004158030.1| PREDICTED: transmembrane protein 184C-like [Cucumis sativus] Length = 294 Score = 61.2 bits (147), Expect = 1e-07 Identities = 24/47 (51%), Positives = 38/47 (80%) Frame = +2 Query: 2 DTKNISAAIQNILVCVEMVIFAVLHQYAYYVTPYSGDFEAKLKLQKD 142 D +++ A QN+L+C+EM++F+VL QYA+ V PYSG+ E KLK++K+ Sbjct: 247 DVEHVEEAFQNVLICLEMIVFSVLQQYAFNVGPYSGEVERKLKMRKN 293 >gb|AFK39908.1| unknown [Medicago truncatula] Length = 276 Score = 61.2 bits (147), Expect = 1e-07 Identities = 28/49 (57%), Positives = 39/49 (79%) Frame = +2 Query: 2 DTKNISAAIQNILVCVEMVIFAVLHQYAYYVTPYSGDFEAKLKLQKDRK 148 D ++I A+QNILVC+EMV+F+VL QYAY+ +PYSG+ E LK Q ++K Sbjct: 227 DVEHIEEAMQNILVCIEMVVFSVLQQYAYHASPYSGEVEKMLK-QNNKK 274 >ref|XP_003593452.1| Transmembrane protein 184C [Medicago truncatula] gi|355482500|gb|AES63703.1| Transmembrane protein 184C [Medicago truncatula] Length = 296 Score = 61.2 bits (147), Expect = 1e-07 Identities = 28/49 (57%), Positives = 39/49 (79%) Frame = +2 Query: 2 DTKNISAAIQNILVCVEMVIFAVLHQYAYYVTPYSGDFEAKLKLQKDRK 148 D ++I A+QNILVC+EMV+F+VL QYAY+ +PYSG+ E LK Q ++K Sbjct: 247 DVEHIEEAMQNILVCIEMVVFSVLQQYAYHASPYSGEVEKMLK-QNNKK 294 >gb|EXB51811.1| hypothetical protein L484_006384 [Morus notabilis] Length = 337 Score = 60.8 bits (146), Expect = 2e-07 Identities = 26/42 (61%), Positives = 34/42 (80%) Frame = +2 Query: 2 DTKNISAAIQNILVCVEMVIFAVLHQYAYYVTPYSGDFEAKL 127 D ++I AIQN+LVC+EMV F+V+ QYAY+ +PYSGD E KL Sbjct: 289 DVEHIEEAIQNVLVCLEMVCFSVIQQYAYHASPYSGDVETKL 330 >ref|XP_007148236.1| hypothetical protein PHAVU_006G191300g [Phaseolus vulgaris] gi|561021459|gb|ESW20230.1| hypothetical protein PHAVU_006G191300g [Phaseolus vulgaris] Length = 296 Score = 60.5 bits (145), Expect = 2e-07 Identities = 28/46 (60%), Positives = 35/46 (76%) Frame = +2 Query: 2 DTKNISAAIQNILVCVEMVIFAVLHQYAYYVTPYSGDFEAKLKLQK 139 D ++I A+QNILVCVEMVIF+VL QYAY+ PYSG+ E L+ K Sbjct: 248 DVEHIEEAMQNILVCVEMVIFSVLQQYAYHPAPYSGEVEKMLRQNK 293 >ref|XP_006417379.1| hypothetical protein EUTSA_v10008344mg [Eutrema salsugineum] gi|557095150|gb|ESQ35732.1| hypothetical protein EUTSA_v10008344mg [Eutrema salsugineum] Length = 295 Score = 60.1 bits (144), Expect = 3e-07 Identities = 22/46 (47%), Positives = 38/46 (82%) Frame = +2 Query: 2 DTKNISAAIQNILVCVEMVIFAVLHQYAYYVTPYSGDFEAKLKLQK 139 + + + A+QN+LVC+EM++F+V+ QYA++V PYSG+ EAK+++ K Sbjct: 248 EVEQLEDALQNVLVCLEMIVFSVMQQYAFHVAPYSGETEAKMRMNK 293