BLASTX nr result
ID: Mentha28_contig00024954
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Mentha28_contig00024954 (429 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EYU40786.1| hypothetical protein MIMGU_mgv11b002117mg [Mimulu... 58 1e-06 >gb|EYU40786.1| hypothetical protein MIMGU_mgv11b002117mg [Mimulus guttatus] Length = 653 Score = 58.2 bits (139), Expect = 1e-06 Identities = 34/65 (52%), Positives = 42/65 (64%), Gaps = 1/65 (1%) Frame = +2 Query: 230 TAESKCSESFKCGNL-TLEFPLAHDKSPGCGLISVYGCDLDPPYPTINLGSGSLGYNIVG 406 +A+S CSESF+CG L LEFP+++ S GCGL +V CD D PT+ L G L YNI Sbjct: 22 SADSHCSESFECGRLGHLEFPISN--STGCGLFTVDDCDSD--NPTVQLEPGGLVYNISR 77 Query: 407 KNSTN 421 STN Sbjct: 78 NMSTN 82