BLASTX nr result
ID: Mentha28_contig00024619
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Mentha28_contig00024619 (434 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EYU18246.1| hypothetical protein MIMGU_mgv1a016649mg [Mimulus... 71 2e-10 ref|XP_007156616.1| hypothetical protein PHAVU_002G003400g [Phas... 59 9e-07 ref|XP_002528789.1| cytochrome C oxidase polypeptide vib, putati... 57 3e-06 ref|XP_004148521.1| PREDICTED: putative cytochrome c oxidase sub... 57 4e-06 >gb|EYU18246.1| hypothetical protein MIMGU_mgv1a016649mg [Mimulus guttatus] Length = 113 Score = 70.9 bits (172), Expect = 2e-10 Identities = 28/47 (59%), Positives = 37/47 (78%) Frame = +2 Query: 137 MRHCYHTYYDYLHRCIQENGADAEACKKVADYYKSSCPDWIGEWEIK 277 MR CY +Y++Y H+CIQE G DA+ CKKV +YYKS CP+WI +W I+ Sbjct: 68 MRLCYDSYHEY-HKCIQEKGKDAQECKKVQEYYKSMCPEWIEKWRIE 113 >ref|XP_007156616.1| hypothetical protein PHAVU_002G003400g [Phaseolus vulgaris] gi|561030031|gb|ESW28610.1| hypothetical protein PHAVU_002G003400g [Phaseolus vulgaris] Length = 131 Score = 58.5 bits (140), Expect = 9e-07 Identities = 24/45 (53%), Positives = 32/45 (71%), Gaps = 1/45 (2%) Frame = +2 Query: 140 RHCYHTYYDYLHRCIQENGADAEACKKVADYYKSSCP-DWIGEWE 271 RHCY Y +Y HRCIQ+ G A C+K+ Y++SSCP +WI EW+ Sbjct: 76 RHCYAKYVEY-HRCIQQKGETAPECQKLGTYFRSSCPSEWITEWD 119 >ref|XP_002528789.1| cytochrome C oxidase polypeptide vib, putative [Ricinus communis] gi|223531792|gb|EEF33611.1| cytochrome C oxidase polypeptide vib, putative [Ricinus communis] Length = 133 Score = 57.0 bits (136), Expect = 3e-06 Identities = 24/44 (54%), Positives = 29/44 (65%), Gaps = 1/44 (2%) Frame = +2 Query: 140 RHCYHTYYDYLHRCIQENGADAEACKKVADYYKSSCP-DWIGEW 268 RHCY Y +Y H+CIQE G DA C K A YY+S CP +W+ W Sbjct: 78 RHCYTRYLEY-HKCIQEKGKDAPECGKFAKYYRSLCPVEWVERW 120 >ref|XP_004148521.1| PREDICTED: putative cytochrome c oxidase subunit 6b-like [Cucumis sativus] gi|449510814|ref|XP_004163766.1| PREDICTED: putative cytochrome c oxidase subunit 6b-like [Cucumis sativus] Length = 149 Score = 56.6 bits (135), Expect = 4e-06 Identities = 23/44 (52%), Positives = 30/44 (68%), Gaps = 1/44 (2%) Frame = +2 Query: 140 RHCYHTYYDYLHRCIQENGADAEACKKVADYYKSSCP-DWIGEW 268 RHCY Y +Y HRC+Q+ G A CKK A YY+S CP +W+ +W Sbjct: 94 RHCYARYLEY-HRCVQKKGEHAPECKKFAKYYRSLCPGEWVEKW 136