BLASTX nr result
ID: Mentha28_contig00024395
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Mentha28_contig00024395 (394 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EYU41565.1| hypothetical protein MIMGU_mgv1a026878mg, partial... 63 5e-08 >gb|EYU41565.1| hypothetical protein MIMGU_mgv1a026878mg, partial [Mimulus guttatus] Length = 722 Score = 62.8 bits (151), Expect = 5e-08 Identities = 30/41 (73%), Positives = 37/41 (90%) Frame = -3 Query: 125 ITRLLKLSRDYADIQLGKALHASIIKVRQDVRLCNSLISSY 3 ++RLLKLS +YADIQLGKA+HAS++K QDVRL NSLI+SY Sbjct: 1 LSRLLKLSIEYADIQLGKAVHASVLKFEQDVRLFNSLITSY 41