BLASTX nr result
ID: Mentha28_contig00024233
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Mentha28_contig00024233 (1037 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EYU24724.1| hypothetical protein MIMGU_mgv1a015220mg [Mimulus... 65 4e-08 gb|EPS62586.1| hypothetical protein M569_12203 [Genlisea aurea] 58 7e-06 >gb|EYU24724.1| hypothetical protein MIMGU_mgv1a015220mg [Mimulus guttatus] Length = 164 Score = 65.5 bits (158), Expect = 4e-08 Identities = 34/39 (87%), Positives = 36/39 (92%) Frame = +1 Query: 841 RHQDIALDMLIKLVRVFSSVI*SLLSAPSSVGLDIEAEQ 957 RHQDIALDML+KLVRVF SVI S LSAPSSVG+DIEAEQ Sbjct: 82 RHQDIALDMLLKLVRVFGSVIYSSLSAPSSVGVDIEAEQ 120 >gb|EPS62586.1| hypothetical protein M569_12203 [Genlisea aurea] Length = 1308 Score = 57.8 bits (138), Expect = 7e-06 Identities = 29/39 (74%), Positives = 34/39 (87%) Frame = +1 Query: 841 RHQDIALDMLIKLVRVFSSVI*SLLSAPSSVGLDIEAEQ 957 RHQDI L +L+KLVRVF S+I S LSAP+SVG+DIEAEQ Sbjct: 1215 RHQDIGLSVLLKLVRVFGSMIYSSLSAPASVGVDIEAEQ 1253