BLASTX nr result
ID: Mentha28_contig00024092
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Mentha28_contig00024092 (338 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EYU18670.1| hypothetical protein MIMGU_mgv1a010492mg [Mimulus... 74 2e-11 ref|XP_007028601.1| Peptide chain release factor, putative isofo... 58 1e-06 ref|XP_007028600.1| Peptide chain release factor 2 isoform 1 [Th... 58 1e-06 gb|EXB93962.1| Peptide chain release factor 2 [Morus notabilis] 55 8e-06 >gb|EYU18670.1| hypothetical protein MIMGU_mgv1a010492mg [Mimulus guttatus] Length = 310 Score = 74.3 bits (181), Expect = 2e-11 Identities = 35/45 (77%), Positives = 39/45 (86%) Frame = -3 Query: 336 KYSFQPTKFVHDLRSGAQFLDVNSVLNGNLDPLIAAHINSRQSST 202 KY F+PTK VHDL+SG+QF DVN VLNG LDPLIAAHI+SRQ ST Sbjct: 264 KYVFRPTKMVHDLKSGSQFPDVNGVLNGKLDPLIAAHISSRQPST 308 >ref|XP_007028601.1| Peptide chain release factor, putative isoform 2 [Theobroma cacao] gi|508717206|gb|EOY09103.1| Peptide chain release factor, putative isoform 2 [Theobroma cacao] Length = 369 Score = 58.2 bits (139), Expect = 1e-06 Identities = 24/46 (52%), Positives = 35/46 (76%) Frame = -3 Query: 336 KYSFQPTKFVHDLRSGAQFLDVNSVLNGNLDPLIAAHINSRQSSTT 199 +Y F P+K V D+++G + D+NSVL+GN++PLI AHIN RQ + T Sbjct: 323 RYMFHPSKLVQDIKTGLELADLNSVLDGNIEPLIGAHINIRQPNCT 368 >ref|XP_007028600.1| Peptide chain release factor 2 isoform 1 [Theobroma cacao] gi|508717205|gb|EOY09102.1| Peptide chain release factor 2 isoform 1 [Theobroma cacao] Length = 420 Score = 58.2 bits (139), Expect = 1e-06 Identities = 24/46 (52%), Positives = 35/46 (76%) Frame = -3 Query: 336 KYSFQPTKFVHDLRSGAQFLDVNSVLNGNLDPLIAAHINSRQSSTT 199 +Y F P+K V D+++G + D+NSVL+GN++PLI AHIN RQ + T Sbjct: 374 RYMFHPSKLVQDIKTGLELADLNSVLDGNIEPLIGAHINIRQPNCT 419 >gb|EXB93962.1| Peptide chain release factor 2 [Morus notabilis] Length = 418 Score = 55.5 bits (132), Expect = 8e-06 Identities = 26/44 (59%), Positives = 34/44 (77%) Frame = -3 Query: 336 KYSFQPTKFVHDLRSGAQFLDVNSVLNGNLDPLIAAHINSRQSS 205 KY P K V D+++G Q +NSVL+GNL+PLIAAHI++RQSS Sbjct: 372 KYMSNPHKLVEDVKTGIQLPGLNSVLDGNLEPLIAAHISTRQSS 415